Protein Family IF05656
Metagenome
Isolate
184
Members
62
Samples
169
Scaffolds
244.7
Avg Length
Representative Sequence
- ID
- 3300042599|Ga0466706_197440|Ga0466706_197440_18861_19688
- Length
- 275 aa
- Sequence
- MTAANLQQWIRHPEQLSRDTLYELRTVVARYPYFQAARLLYLKNLYLLHDADFGAELRRAVIYVGDRRVLFLLIEGDNFVERLKRKNEANGSGETAPDITEPSVDRTLALIDAFLATVPSDLHAPTSLDYTVDYTSYLLDTPVEPAADGDDECPKLKGQSLIDDFIEQNADTRRTPKSPVNRETGETPEAGTDEATDVNIGEDDEKETPKESFAEAEADDGYFTETLAHIYIRQRRYSKALEIIRRLSLKYPQKNTYFADQIRFLEKLIINANSK
Sample Types
Isolate
8.2%
Metagenome
91.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
29.5%
Kalotermitidae
23.0%
Blattidae
18.0%
Unclassified
11.5%
Termopsidae
6.6%
Rhinotermitidae
4.9%
Passalidae
4.9%
Hodotermitidae
1.6%
Taxonomy
Archaea
0
Bacteria
184
Eukaryota
0
Viruses
0
Unclassified
0
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 2 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 3 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 4 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 5 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 6 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 7 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 8 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 11 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 12 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 13 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 14 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 15 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 16 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 17 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 18 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 19 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 20 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 21 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 22 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 23 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 24 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 25 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 26 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 27 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 28 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 29 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 30 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 31 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 32 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 33 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 34 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 35 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 36 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 37 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 38 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 39 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 40 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 41 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 42 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 43 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 44 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 45 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 46 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 47 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 48 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 49 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 50 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 51 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 52 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 53 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 54 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 55 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 56 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 57 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 58 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 59 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 60 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 61 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 62 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466713_089753 | 3300042602 | Bacteria | 35618 |
| 2 | Ga0466716_535552 | 3300042605 | Bacteria | 5568 |
| 3 | Ga0466722_043134 | 3300042609 | Bacteria | 89421 |
| 4 | Ga0466722_244426 | 3300042609 | Bacteria | 2083 |
| 5 | Ga0068305_10037746 | 3300005083 | Bacteria | 21674 |
| 6 | Ga0466703_148815 | 3300042636 | Bacteria | 16579 |
| 7 | Ga0466703_176934 | 3300042636 | Bacteria | 5044 |
| 8 | Ga0466703_232598 | 3300042636 | Bacteria | 11554 |
| 9 | Ga0466703_250134 | 3300042636 | Bacteria | 18299 |
| 10 | Ga0466704_094066 | 3300042643 | Bacteria | 24442 |
| 11 | Ga0466708_289367 | 3300042652 | Bacteria | 4187 |
| 12 | Ga0265387_1007104 | 3300024582 | Bacteria | 1502 |
| 13 | Ga0466657_385427 | 3300042582 | Bacteria | 4202 |
| 14 | Ga0466690_069343 | 3300042590 | Bacteria | 17759 |
| 15 | Ga0466690_334959 | 3300042590 | Bacteria | 17522 |
| 16 | Ga0466692_202144 | 3300042591 | Bacteria | 41419 |
| 17 | Ga0466693_065613 | 3300042592 | Bacteria | 1284 |
| 18 | Ga0466691_098703 | 3300042593 | Bacteria | 4700 |
| 19 | Ga0466711_011264 | 3300042615 | Bacteria | 6001 |
| 20 | Ga0466711_100420 | 3300042615 | Bacteria | 9741 |
| 21 | Ga0466715_034225 | 3300042616 | Bacteria | 16942 |
| 22 | Ga0466715_063927 | 3300042616 | Bacteria | 20242 |
| 23 | Ga0466715_110752 | 3300042616 | Bacteria | 8045 |
| 24 | Ga0466728_016383 | 3300042620 | Bacteria | 48703 |
| 25 | Ga0466733_030815 | 3300042659 | Bacteria | 19476 |
| 26 | Ga0123357_10008856 | 3300009784 | Bacteria | 12635 |
| 27 | Ga0123356_10033934 | 3300010049 | Bacteria | 4772 |
| 28 | Ga0466706_060160 | 3300042599 | Bacteria | 4112 |
| 29 | Ga0466706_118269 | 3300042599 | Bacteria | 2336 |
| 30 | Ga0466719_065003 | 3300042606 | Bacteria | 9724 |
| 31 | Ga0466719_541364 | 3300042606 | Bacteria | 3220 |
| 32 | Ga0466722_132116 | 3300042609 | Bacteria | 5856 |
| 33 | Ga0466722_263608 | 3300042609 | Bacteria | 34147 |
| 34 | JGI24705J35276_12238107 | 3300002504 | Bacteria | 15966 |
| 35 | Ga0466735_013515 | 3300042624 | Bacteria | 4734 |
| 36 | Ga0466703_233451 | 3300042636 | Bacteria | 2301 |
| 37 | Ga0466704_151669 | 3300042643 | Bacteria | 5189 |
| 38 | Ga0466708_014247 | 3300042652 | Bacteria | 21773 |
| 39 | Ga0466725_064754 | 3300042654 | Bacteria | 6296 |
| 40 | Ga0466725_193589 | 3300042654 | Bacteria | 4127 |
| 41 | Ga0466691_007963 | 3300042593 | Bacteria | 6577 |
| 42 | Ga0466696_229029 | 3300042596 | Bacteria | 4520 |
| 43 | Ga0466711_196937 | 3300042615 | Bacteria | 36467 |
| 44 | Ga0466723_014851 | 3300042618 | Bacteria | 13167 |
| 45 | Ga0466723_070186 | 3300042618 | Bacteria | 30269 |
| 46 | Ga0123354_10071882 | 3300010882 | Bacteria | 4988 |
| 47 | Ga0466706_255100 | 3300042599 | Bacteria | 11194 |
| 48 | Ga0466700_461092 | 3300042600 | Bacteria | 1139 |
| 49 | Ga0466707_132567 | 3300042601 | Bacteria | 1930 |
| 50 | Ga0466716_506150 | 3300042605 | Bacteria | 11490 |
| 51 | Ga0466719_079549 | 3300042606 | Bacteria | 6297 |
| 52 | JGI24702J35022_10001952 | 3300002462 | Bacteria | 12711 |
| 53 | JGI24702J35022_10195092 | 3300002462 | Bacteria | 1156 |
| 54 | JGI24705J35276_12213483 | 3300002504 | Bacteria | 1926 |
| 55 | Ga0466735_102645 | 3300042624 | Bacteria | 21461 |
| 56 | Ga0466704_532198 | 3300042643 | Bacteria | 2561 |
| 57 | Ga0466708_060683 | 3300042652 | Bacteria | 49198 |
| 58 | Ga0466708_233940 | 3300042652 | Bacteria | 9713 |
| 59 | Ga0466727_119767 | 3300042655 | Bacteria | 1410 |
| 60 | Ga0466692_047378 | 3300042591 | Bacteria | 93081 |
| 61 | Ga0466715_193888 | 3300042616 | Bacteria | 87863 |
| 62 | Ga0466715_624866 | 3300042616 | Bacteria | 14808 |
| 63 | Ga0466723_047289 | 3300042618 | Bacteria | 12837 |
| 64 | Ga0466726_485037 | 3300042619 | Bacteria | 18142 |
| 65 | Ga0466733_096868 | 3300042659 | Bacteria | 74750 |
| 66 | Ga0466733_213890 | 3300042659 | Bacteria | 4087 |
| 67 | Ga0466706_161606 | 3300042599 | Bacteria | 2580 |
| 68 | Ga0466707_264855 | 3300042601 | Bacteria | 1078 |
| 69 | Ga0466713_028113 | 3300042602 | Bacteria | 7191 |
| 70 | Ga0466713_082046 | 3300042602 | Bacteria | 24947 |
| 71 | 2227063698 | 2225789003 | Bacteria | 16706 |
| 72 | 2227527402 | 2225789004 | Bacteria | 16682 |
| 73 | IMNBL1DRAFT_c0003741 | 3300000062 | Bacteria | 9531 |
| 74 | JGI24696J40584_12924354 | 3300002834 | Bacteria | 1387 |
| 75 | Ga0068305_10073289 | 3300005083 | Bacteria | 3926 |
| 76 | Ga0466697_258576 | 3300042611 | Bacteria | 357278 |
| 77 | Ga0466705_112010 | 3300042612 | Bacteria | 1056 |
| 78 | Ga0466735_046855 | 3300042624 | Bacteria | 10270 |
| 79 | Ga0466735_149918 | 3300042624 | Bacteria | 3613 |
| 80 | Ga0466703_079229 | 3300042636 | Bacteria | 1511 |
| 81 | Ga0466704_154577 | 3300042643 | Bacteria | 5663 |
| 82 | Ga0466709_405290 | 3300042648 | Bacteria | 5024 |
| 83 | Ga0466708_185973 | 3300042652 | Bacteria | 10794 |
| 84 | Ga0466727_225870 | 3300042655 | Bacteria | 4480 |
| 85 | Ga0466690_248909 | 3300042590 | Bacteria | 9190 |
| 86 | Ga0466690_375807 | 3300042590 | Bacteria | 12353 |
| 87 | Ga0466692_131879 | 3300042591 | Bacteria | 47901 |
| 88 | Ga0466691_012716 | 3300042593 | Bacteria | 19248 |
| 89 | Ga0466696_287535 | 3300042596 | Bacteria | 43348 |
| 90 | Ga0466711_476288 | 3300042615 | Bacteria | 8644 |
| 91 | Ga0466728_220670 | 3300042620 | Bacteria | 33359 |
| 92 | Ga0123353_10183156 | 3300010167 | Bacteria | 3314 |
| 93 | Ga0466706_074761 | 3300042599 | Bacteria | 5280 |
| 94 | Ga0466706_259930 | 3300042599 | Bacteria | 14269 |
| 95 | Ga0466713_081814 | 3300042602 | Bacteria | 6368 |
| 96 | Ga0466716_078621 | 3300042605 | Bacteria | 19363 |
| 97 | Ga0466716_320693 | 3300042605 | Bacteria | 2960 |
| 98 | Ga0466716_340066 | 3300042605 | Bacteria | 22650 |
| 99 | 2227468526 | 2225789004 | Bacteria | 5003 |
| 100 | IMNBL1DRAFT_c0008449 | 3300000062 | Bacteria | 5236 |
| 101 | JGI24702J35022_10054553 | 3300002462 | Bacteria | 2132 |
| 102 | JGI24702J35022_10097548 | 3300002462 | Bacteria | 1605 |
| 103 | JGI24699J35502_11134227 | 3300002509 | Bacteria | 76542 |
| 104 | Ga0466735_200050 | 3300042624 | Bacteria | 3881 |
| 105 | Ga0466703_239733 | 3300042636 | Bacteria | 28849 |
| 106 | Ga0466704_052221 | 3300042643 | Bacteria | 9879 |
| 107 | Ga0466727_011844 | 3300042655 | Bacteria | 5311 |
| 108 | Ga0466727_240150 | 3300042655 | Bacteria | 3115 |
| 109 | Ga0466690_149426 | 3300042590 | Bacteria | 7591 |
| 110 | Ga0466691_022426 | 3300042593 | Bacteria | 71333 |
| 111 | Ga0466696_074059 | 3300042596 | Bacteria | 10856 |
| 112 | Ga0466711_220936 | 3300042615 | Bacteria | 6473 |
| 113 | Ga0123357_10028511 | 3300009784 | Bacteria | 7559 |
| 114 | Ga0123354_10010789 | 3300010882 | Bacteria | 14099 |
| 115 | Ga0466706_012247 | 3300042599 | Bacteria | 6840 |
| 116 | Ga0466706_115643 | 3300042599 | Bacteria | 11447 |
| 117 | Ga0466700_304523 | 3300042600 | Bacteria | 3726 |
| 118 | Ga0466707_109853 | 3300042601 | Bacteria | 18130 |
| 119 | Ga0466713_045299 | 3300042602 | Bacteria | 8584 |
| 120 | Ga0466722_008321 | 3300042609 | Bacteria | 8234 |
| 121 | 2227532116 | 2225789004 | Bacteria | 3134 |
| 122 | JGI24702J35022_10044568 | 3300002462 | Bacteria | 2364 |
| 123 | Ga0466705_036506 | 3300042612 | Bacteria | 5725 |
| 124 | Ga0466735_068691 | 3300042624 | Bacteria | 9917 |
| 125 | Ga0466724_33989 | 3300042649 | Bacteria | 1249 |
| 126 | Ga0466727_138028 | 3300042655 | Bacteria | 18367 |
| 127 | Ga0466656_187408 | 3300042550 | Bacteria | 7556 |
| 128 | Ga0466690_113175 | 3300042590 | Bacteria | 17999 |
| 129 | Ga0466690_245129 | 3300042590 | Bacteria | 16092 |
| 130 | Ga0466693_278342 | 3300042592 | Bacteria | 1518 |
| 131 | Ga0466691_082783 | 3300042593 | Bacteria | 28065 |
| 132 | Ga0466696_302479 | 3300042596 | Bacteria | 58494 |
| 133 | Ga0466710_436274 | 3300042613 | Bacteria | 4721 |
| 134 | Ga0466715_057006 | 3300042616 | Bacteria | 8544 |
| 135 | Ga0466715_083069 | 3300042616 | Bacteria | 26157 |
| 136 | Ga0123357_10025099 | 3300009784 | Bacteria | 8035 |
| 137 | Ga0466706_197440 | 3300042599 | Bacteria | 24639 |
| 138 | Ga0466716_025507 | 3300042605 | Bacteria | 2046 |
| 139 | JGI24699J35502_11134123 | 3300002509 | Bacteria | 34108 |
| 140 | Ga0068302_10041915 | 3300005071 | Bacteria | 10017 |
| 141 | Ga0466735_120177 | 3300042624 | Bacteria | 1130 |
| 142 | Ga0466735_154167 | 3300042624 | Bacteria | 2480 |
| 143 | Ga0466704_073764 | 3300042643 | Bacteria | 58999 |
| 144 | Ga0466704_116828 | 3300042643 | Bacteria | 10950 |
| 145 | Ga0466704_121749 | 3300042643 | Bacteria | 14567 |
| 146 | Ga0466708_257049 | 3300042652 | Bacteria | 1566 |
| 147 | Ga0466727_249777 | 3300042655 | Bacteria | 11525 |
| 148 | Ga0466694_333659 | 3300042594 | Bacteria | 7378 |
| 149 | Ga0466715_431927 | 3300042616 | Bacteria | 29895 |
| 150 | Ga0466726_231922 | 3300042619 | Bacteria | 4030 |
| 151 | Ga0466729_180265 | 3300042621 | Bacteria | 15549 |
| 152 | Ga0123354_10333812 | 3300010882 | Bacteria | 1378 |
| 153 | Ga0466706_245430 | 3300042599 | Bacteria | 57044 |
| 154 | Ga0466707_320477 | 3300042601 | Bacteria | 18661 |
| 155 | Ga0466713_072265 | 3300042602 | Bacteria | 40264 |
| 156 | Ga0466713_109063 | 3300042602 | Bacteria | 21346 |
| 157 | Ga0466719_236394 | 3300042606 | Bacteria | 1007 |
| 158 | IMNBL1DRAFT_c0000298 | 3300000062 | Bacteria | 42272 |
| 159 | IMNBL1DRAFT_c0004532 | 3300000062 | Bacteria | 8302 |
| 160 | Ga0466705_147814 | 3300042612 | Bacteria | 1019 |
| 161 | Ga0466735_114938 | 3300042624 | Bacteria | 1450 |
| 162 | Ga0466703_175370 | 3300042636 | Bacteria | 7579 |
| 163 | Ga0466709_110644 | 3300042648 | Bacteria | 26395 |
| 164 | Ga0466727_059108 | 3300042655 | Bacteria | 16126 |
| 165 | Ga0466692_048325 | 3300042591 | Bacteria | 14646 |
| 166 | Ga0466710_117443 | 3300042613 | Bacteria | 10725 |
| 167 | Ga0466711_028440 | 3300042615 | Bacteria | 19103 |
| 168 | Ga0466711_083476 | 3300042615 | Bacteria | 22236 |
| 169 | Ga0466715_173384 | 3300042616 | Bacteria | 14345 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.