Protein Family IF05609
Metagenome
Isolate
208
Members
74
Samples
189
Scaffolds
252.07
Avg Length
Representative Sequence
- ID
- 3300042599|Ga0466706_104685|Ga0466706_104685_4437_5297
- Length
- 273 aa
- Sequence
- MSEQTVVFERTRVLTPKHTHYCPGCTHGIAHRLVAEVIDELGIQEKTIGVCPVGCSVLAYDYFDLDMQEAAHGRAPAVATGIRRVLPPDRYVFTYQGDGDLASIGMAEIVHAANRGEKLTVVFINNGIYGMTGGQMAPTTLPGMKTTTSPYGRKPEECGHPIRVSELLNTLVAPRFIARGALSSVKEIVRAKRLIRQAFELQHTGFTFVELLSTCPTGWGLPPDKAMRWLEHNMMPFFKTGVLRGPDAMPEAAMPYAPDLTVGDAKSTNGKEA
Sample Types
Isolate
9.1%
Metagenome
90.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.0%
Unclassified
26.0%
Kalotermitidae
19.2%
Rhinotermitidae
5.5%
Termopsidae
5.5%
Blattidae
2.7%
Passalidae
2.7%
Hodotermitidae
1.4%
Taxonomy
Archaea
0
Bacteria
192
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 2 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 3 | 2820068815 | Unclassified Proteobacteria Nt197P3bin4 | Isolate | Unclassified |
| 4 | 2820463629 | Unclassified Firmicutes Lab288P3bin124 | Isolate | Unclassified |
| 5 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 6 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 7 | 2820254385 | Unclassified Firmicutes Th196P3bin54 | Isolate | Unclassified |
| 8 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 12 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 13 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 14 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 15 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 16 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 17 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 18 | 2820781750 | Unclassified Bacteroidetes Emb289P3bin89 | Isolate | Unclassified |
| 19 | 2820570671 | Unclassified Firmicutes Emb289P3bin19 | Isolate | Unclassified |
| 20 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 21 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 22 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 23 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 24 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 25 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 26 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 27 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 28 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 29 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 30 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 31 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 32 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 33 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 34 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 35 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 36 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 37 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 38 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 39 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 40 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 41 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 42 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 43 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 44 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 45 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 46 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 47 | 2820453354 | Unclassified Firmicutes Lab288P3bin172 | Isolate | Unclassified |
| 48 | 2820560510 | Unclassified Firmicutes Emb289P3bin72 | Isolate | Unclassified |
| 49 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 50 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 51 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 52 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 53 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 54 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 55 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 56 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 57 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 58 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 59 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 60 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 61 | 2820294436 | Unclassified Firmicutes Th196P3bin104 | Isolate | Unclassified |
| 62 | 2820321184 | Unclassified Firmicutes Nt197P3bin86 | Isolate | Unclassified |
| 63 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 64 | 8064531044 | Terrisporobacter mayombei DSM 6539 | Isolate | Unclassified |
| 65 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 66 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 67 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 68 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 69 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 70 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 71 | 2508501043 | Desulfovibrio termitidis HI1 | Isolate | Rhinotermitidae |
| 72 | 2820244222 | Unclassified Firmicutes Th196P3bin75 | Isolate | Unclassified |
| 73 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 74 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_039484 | 3300042659 | Bacteria | 48204 |
| 2 | Ga0466705_492394 | 3300042612 | Bacteria | 1884 |
| 3 | Ga0466711_058717 | 3300042615 | Bacteria | 8602 |
| 4 | Ga0466711_214064 | 3300042615 | Unclassified | 1651 |
| 5 | Ga0466726_118645 | 3300042619 | Bacteria | 5836 |
| 6 | Ga0466729_097881 | 3300042621 | Unclassified | 1881 |
| 7 | Ga0123353_10475639 | 3300010167 | Bacteria | 1830 |
| 8 | Ga0466706_131508 | 3300042599 | Bacteria | 13139 |
| 9 | Ga0466706_201589 | 3300042599 | Bacteria | 1949 |
| 10 | Ga0466706_278591 | 3300042599 | Bacteria | 28050 |
| 11 | Ga0466713_022952 | 3300042602 | Bacteria | 19139 |
| 12 | Ga0466719_180231 | 3300042606 | Bacteria | 22873 |
| 13 | Ga0466719_497467 | 3300042606 | Bacteria | 1287 |
| 14 | Ga0466722_204361 | 3300042609 | Bacteria | 3636 |
| 15 | Ga0466729_216680 | 3300042621 | Bacteria | 28465 |
| 16 | Ga0466702_129145 | 3300042635 | Bacteria | 18302 |
| 17 | Ga0466704_482970 | 3300042643 | Bacteria | 19469 |
| 18 | Ga0466709_177692 | 3300042648 | Bacteria | 1646 |
| 19 | Ga0466708_363355 | 3300042652 | Bacteria | 3253 |
| 20 | Ga0264413_120765 | 3300024493 | Bacteria | 3784 |
| 21 | Ga0264413_142639 | 3300024493 | Bacteria | 2511 |
| 22 | Ga0466693_073630 | 3300042592 | Bacteria | 1256 |
| 23 | Ga0466691_095138 | 3300042593 | Bacteria | 5034 |
| 24 | Ga0466733_074614 | 3300042659 | Bacteria | 5548 |
| 25 | Ga0466711_056937 | 3300042615 | Bacteria | 19166 |
| 26 | Ga0466718_050665 | 3300042617 | Bacteria | 16279 |
| 27 | Ga0466728_332014 | 3300042620 | Bacteria | 1510 |
| 28 | Ga0123355_10348514 | 3300009826 | Bacteria | 1964 |
| 29 | Ga0123356_10360563 | 3300010049 | Bacteria | 1580 |
| 30 | Ga0123354_10386433 | 3300010882 | Bacteria | 1202 |
| 31 | Ga0466706_069931 | 3300042599 | Bacteria | 4758 |
| 32 | Ga0466714_115346 | 3300042603 | Bacteria | 1088 |
| 33 | IMNBL1DRAFT_c0016070 | 3300000062 | Bacteria | 3219 |
| 34 | JGI24698J34947_10053822 | 3300002449 | Bacteria | 2012 |
| 35 | JGI24702J35022_10016334 | 3300002462 | Bacteria | 4069 |
| 36 | JGI24705J35276_12238458 | 3300002504 | Bacteria | 22868 |
| 37 | Ga0466729_309431 | 3300042621 | Bacteria | 11898 |
| 38 | Ga0466735_151811 | 3300042624 | Bacteria | 2733 |
| 39 | Ga0466735_168265 | 3300042624 | Bacteria | 3796 |
| 40 | Ga0466703_148447 | 3300042636 | Bacteria | 7678 |
| 41 | Ga0466704_457726 | 3300042643 | Bacteria | 7453 |
| 42 | Ga0466708_242242 | 3300042652 | Bacteria | 10160 |
| 43 | Ga0466696_098389 | 3300042596 | Bacteria | 1604 |
| 44 | Ga0466728_184337 | 3300042620 | Bacteria | 7189 |
| 45 | Ga0123357_10236774 | 3300009784 | Unclassified | 1987 |
| 46 | Ga0123355_10000960 | 3300009826 | Bacteria | 39870 |
| 47 | Ga0123354_10023165 | 3300010882 | Bacteria | 9794 |
| 48 | Ga0466701_036685 | 3300042598 | Unclassified | 4020 |
| 49 | Ga0466706_054115 | 3300042599 | Bacteria | 9491 |
| 50 | Ga0466706_062858 | 3300042599 | Bacteria | 29571 |
| 51 | Ga0466706_208147 | 3300042599 | Bacteria | 3829 |
| 52 | Ga0466707_326330 | 3300042601 | Bacteria | 275336 |
| 53 | Ga0466714_162435 | 3300042603 | Bacteria | 2652 |
| 54 | 2227605185 | 2225789004 | Bacteria | 12251 |
| 55 | JGI24699J35502_11134208 | 3300002509 | Bacteria | 58698 |
| 56 | Ga0123357_10001158 | 3300009784 | Bacteria | 27473 |
| 57 | Ga0466709_400581 | 3300042648 | Unclassified | 6893 |
| 58 | Ga0466727_278871 | 3300042655 | Bacteria | 12509 |
| 59 | Ga0415639_001158 | 3300038395 | Bacteria | 21731 |
| 60 | Ga0466690_251639 | 3300042590 | Bacteria | 10986 |
| 61 | Ga0466691_092847 | 3300042593 | Unclassified | 1731 |
| 62 | Ga0466691_133076 | 3300042593 | Bacteria | 13556 |
| 63 | Ga0466691_140254 | 3300042593 | Bacteria | 8192 |
| 64 | Ga0466705_046890 | 3300042612 | Bacteria | 10925 |
| 65 | Ga0466733_032150 | 3300042659 | Unclassified | 1672 |
| 66 | Ga0466733_035409 | 3300042659 | Bacteria | 7885 |
| 67 | Ga0466733_040416 | 3300042659 | Bacteria | 2761 |
| 68 | Ga0466711_173848 | 3300042615 | Bacteria | 2598 |
| 69 | Ga0466718_122340 | 3300042617 | Bacteria | 1208 |
| 70 | Ga0466728_363843 | 3300042620 | Bacteria | 17872 |
| 71 | Ga0123357_10004404 | 3300009784 | Bacteria | 16524 |
| 72 | Ga0123356_10173727 | 3300010049 | Bacteria | 2168 |
| 73 | Ga0466706_104685 | 3300042599 | Bacteria | 18370 |
| 74 | Ga0466706_170277 | 3300042599 | Unclassified | 1781 |
| 75 | Ga0466707_377742 | 3300042601 | Bacteria | 6594 |
| 76 | Ga0466713_078329 | 3300042602 | Bacteria | 27454 |
| 77 | Ga0466714_063470 | 3300042603 | Bacteria | 3756 |
| 78 | IMNBL1DRAFT_c0000303 | 3300000062 | Bacteria | 41914 |
| 79 | JGI24699J35502_11134214 | 3300002509 | Bacteria | 63548 |
| 80 | Ga0068302_10203005 | 3300005071 | Bacteria | 4127 |
| 81 | Ga0068305_10003475 | 3300005083 | Bacteria | 10580 |
| 82 | Ga0068305_10030692 | 3300005083 | Bacteria | 7911 |
| 83 | Ga0466735_047127 | 3300042624 | Bacteria | 1553 |
| 84 | Ga0466709_298743 | 3300042648 | Unclassified | 2283 |
| 85 | Ga0415639_029467 | 3300038395 | Bacteria | 14926 |
| 86 | Ga0466691_021872 | 3300042593 | Bacteria | 6023 |
| 87 | Ga0466696_169541 | 3300042596 | Bacteria | 7923 |
| 88 | Ga0466701_000546 | 3300042598 | Bacteria | 7787 |
| 89 | Ga0466733_116589 | 3300042659 | Bacteria | 12014 |
| 90 | Ga0466705_425320 | 3300042612 | Bacteria | 6449 |
| 91 | Ga0466711_502697 | 3300042615 | Bacteria | 6201 |
| 92 | Ga0466728_167733 | 3300042620 | Bacteria | 6081 |
| 93 | Ga0123357_10059891 | 3300009784 | Bacteria | 5109 |
| 94 | Ga0123356_10052972 | 3300010049 | Bacteria | 3776 |
| 95 | Ga0123353_10000466 | 3300010167 | Bacteria | 50584 |
| 96 | Ga0123353_10018823 | 3300010167 | Bacteria | 10232 |
| 97 | Ga0123353_10235197 | 3300010167 | Bacteria | 2852 |
| 98 | Ga0123353_10441335 | 3300010167 | Bacteria | 1920 |
| 99 | Ga0466706_124183 | 3300042599 | Bacteria | 3791 |
| 100 | Ga0466706_182771 | 3300042599 | Bacteria | 5073 |
| 101 | Ga0466700_018134 | 3300042600 | Bacteria | 5994 |
| 102 | Ga0466717_278875 | 3300042604 | Bacteria | 1013 |
| 103 | Ga0466716_376194 | 3300042605 | Bacteria | 3696 |
| 104 | Ga0466719_164605 | 3300042606 | Bacteria | 4418 |
| 105 | Ga0466721_056133 | 3300042608 | Bacteria | 1001 |
| 106 | IMNBL1DRAFT_c0000270 | 3300000062 | Bacteria | 45954 |
| 107 | AustNasuHG_c1000003 | 3300000089 | Bacteria | 67820 |
| 108 | Ga0466731_278615 | 3300042622 | Bacteria | 1027 |
| 109 | Ga0466702_131380 | 3300042635 | Bacteria | 61952 |
| 110 | Ga0466696_304901 | 3300042596 | Bacteria | 4678 |
| 111 | Ga0466696_488609 | 3300042596 | Bacteria | 4358 |
| 112 | Ga0466697_200680 | 3300042611 | Bacteria | 1074 |
| 113 | Ga0466712_307511 | 3300042614 | Bacteria | 4540 |
| 114 | Ga0466715_053587 | 3300042616 | Bacteria | 1992 |
| 115 | Ga0466715_232647 | 3300042616 | Bacteria | 2842 |
| 116 | Ga0466718_033754 | 3300042617 | Bacteria | 17277 |
| 117 | Ga0466718_074297 | 3300042617 | Bacteria | 2020 |
| 118 | Ga0466723_068620 | 3300042618 | Bacteria | 26399 |
| 119 | Ga0466726_251644 | 3300042619 | Bacteria | 1587 |
| 120 | Ga0123357_10008089 | 3300009784 | Bacteria | 13100 |
| 121 | Ga0123357_10547379 | 3300009784 | Bacteria | 926 |
| 122 | Ga0123356_10000006 | 3300010049 | Bacteria | 247371 |
| 123 | Ga0123356_10000190 | 3300010049 | Bacteria | 70996 |
| 124 | Ga0123353_10180936 | 3300010167 | Bacteria | 3337 |
| 125 | Ga0123354_10000458 | 3300010882 | Bacteria | 40359 |
| 126 | Ga0466706_004219 | 3300042599 | Bacteria | 16657 |
| 127 | Ga0466706_018858 | 3300042599 | Bacteria | 5408 |
| 128 | Ga0466713_149568 | 3300042602 | Bacteria | 40583 |
| 129 | Ga0466714_036966 | 3300042603 | Bacteria | 6276 |
| 130 | Ga0466721_021864 | 3300042608 | Bacteria | 51971 |
| 131 | Ga0072940_1121974 | 3300005200 | Bacteria | 1698 |
| 132 | Ga0466708_318982 | 3300042652 | Unclassified | 19239 |
| 133 | Ga0466727_156758 | 3300042655 | Bacteria | 3849 |
| 134 | Ga0466727_245681 | 3300042655 | Bacteria | 65513 |
| 135 | Ga0466727_256550 | 3300042655 | Bacteria | 2318 |
| 136 | Ga0415639_061431 | 3300038395 | Unclassified | 3039 |
| 137 | Ga0466692_125592 | 3300042591 | Bacteria | 24192 |
| 138 | Ga0466694_106058 | 3300042594 | Bacteria | 1256 |
| 139 | Ga0466696_294131 | 3300042596 | Bacteria | 14401 |
| 140 | Ga0466705_464594 | 3300042612 | Bacteria | 4358 |
| 141 | Ga0466711_329973 | 3300042615 | Bacteria | 7468 |
| 142 | Ga0466711_484683 | 3300042615 | Bacteria | 2498 |
| 143 | Ga0466715_052222 | 3300042616 | Unclassified | 1993 |
| 144 | Ga0466715_063988 | 3300042616 | Bacteria | 6790 |
| 145 | Ga0466715_138418 | 3300042616 | Bacteria | 28149 |
| 146 | Ga0466715_305368 | 3300042616 | Bacteria | 16066 |
| 147 | Ga0466723_175594 | 3300042618 | Unclassified | 2494 |
| 148 | Ga0466726_090928 | 3300042619 | Bacteria | 2160 |
| 149 | Ga0123357_10338033 | 3300009784 | Bacteria | 1460 |
| 150 | Ga0123353_10000014 | 3300010167 | Bacteria | 204767 |
| 151 | Ga0123354_10001537 | 3300010882 | Bacteria | 28281 |
| 152 | Ga0466706_037013 | 3300042599 | Bacteria | 55068 |
| 153 | Ga0466719_459782 | 3300042606 | Unclassified | 1006 |
| 154 | 2227275225 | 2225789004 | Bacteria | 30519 |
| 155 | IMNBL1DRAFT_c0019215 | 3300000062 | Bacteria | 2808 |
| 156 | IMNBL1DRAFT_c0033980 | 3300000062 | Unclassified | 1820 |
| 157 | JGI24698J34947_10074171 | 3300002449 | Bacteria | 1622 |
| 158 | Ga0123357_10000769 | 3300009784 | Bacteria | 32386 |
| 159 | Ga0466703_354286 | 3300042636 | Bacteria | 6959 |
| 160 | Ga0466704_408836 | 3300042643 | Bacteria | 6831 |
| 161 | Ga0466697_086743 | 3300042611 | Bacteria | 3603 |
| 162 | Ga0466705_224252 | 3300042612 | Bacteria | 7752 |
| 163 | Ga0466733_022570 | 3300042659 | Bacteria | 4015 |
| 164 | Ga0466733_101997 | 3300042659 | Bacteria | 1904 |
| 165 | Ga0466705_430497 | 3300042612 | Bacteria | 5734 |
| 166 | Ga0466710_248204 | 3300042613 | Bacteria | 1726 |
| 167 | Ga0466710_321982 | 3300042613 | Bacteria | 1014 |
| 168 | Ga0466715_217657 | 3300042616 | Bacteria | 18865 |
| 169 | Ga0466723_129136 | 3300042618 | Bacteria | 27423 |
| 170 | Ga0123355_10091542 | 3300009826 | Bacteria | 4821 |
| 171 | Ga0123356_10087303 | 3300010049 | Bacteria | 2963 |
| 172 | Ga0123353_10070751 | 3300010167 | Bacteria | 5606 |
| 173 | Ga0123353_10070756 | 3300010167 | Bacteria | 5606 |
| 174 | Ga0123353_10499645 | 3300010167 | Bacteria | 1773 |
| 175 | Ga0123353_10928635 | 3300010167 | Unclassified | 1180 |
| 176 | Ga0466701_096756 | 3300042598 | Bacteria | 1510 |
| 177 | Ga0466700_020224 | 3300042600 | Bacteria | 23800 |
| 178 | Ga0466713_109573 | 3300042602 | Bacteria | 6566 |
| 179 | Ga0466714_025997 | 3300042603 | Bacteria | 1309 |
| 180 | Ga0466716_327829 | 3300042605 | Bacteria | 7964 |
| 181 | Ga0466716_518992 | 3300042605 | Bacteria | 11175 |
| 182 | IMNBL1DRAFT_c0042119 | 3300000062 | Bacteria | 1526 |
| 183 | Ga0072940_1111730 | 3300005200 | Bacteria | 6035 |
| 184 | Ga0466703_066112 | 3300042636 | Bacteria | 22062 |
| 185 | Ga0466708_401701 | 3300042652 | Bacteria | 13666 |
| 186 | Ga0264413_149492 | 3300024493 | Bacteria | 8155 |
| 187 | Ga0415639_009608 | 3300038395 | Bacteria | 4545 |
| 188 | Ga0466656_179422 | 3300042550 | Bacteria | 1313 |
| 189 | Ga0466696_085915 | 3300042596 | Bacteria | 14982 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02775 | TPP_enzyme_C | Thiamine pyrophosphate enzyme, C-terminal TPP binding domain | 66 | 210 | 0.84 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.