Protein Family IF05604
Metagenome
Isolate
213
Members
75
Samples
205
Scaffolds
273.38
Avg Length
Representative Sequence
- ID
- 3300042599|Ga0466706_098228|Ga0466706_098228_14938_15762
- Length
- 268 aa
- Sequence
- MAVRKFKPTTPGQRHKIIGSFETITASVPEKSLVTGIRKTGGRNHVGKMTMRYIGGGHKRKYRVIDFKRDKDGVPATVKTIEYDPNRSARIALLFYADGEKRYILAPNGLQVGQQLMSGSDAAPEIGNSLPLGTIHNVELHPGQGAALVRSAGTFAQLTSREGKYAIVKLPSGETRMILCTCKATVGSVGNSDHALERSGKAGRSRWLGRRPRTRAVVMNPVDHPMGGGEGRQSGGHPRSRKGLLAKGYKTRAPKKASNKYIIERRKK
Sample Types
Isolate
3.8%
Metagenome
96.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.9%
Kalotermitidae
20.0%
Unclassified
10.0%
Termopsidae
5.7%
Drosophilidae
4.3%
Rhinotermitidae
4.3%
Blattidae
2.9%
Formicidae
2.9%
Passalidae
2.9%
Bombycidae
1.4%
Hodotermitidae
1.4%
Cryptocercidae
1.4%
Taxonomy
Archaea
0
Bacteria
198
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 2 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 3 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 4 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 5 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 6 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 7 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 8 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 9 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 10 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 11 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 12 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 13 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 14 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 15 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 16 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 17 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 18 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 19 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 20 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 21 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 22 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 23 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 24 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 25 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 26 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 27 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 28 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 29 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 30 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 31 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 32 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 33 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 34 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 35 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 36 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 37 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 38 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 39 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 40 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 41 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 42 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 43 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 44 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 45 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 46 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 47 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 48 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 49 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 50 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 51 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 52 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 53 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 54 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 55 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 56 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 57 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 58 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 59 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 60 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 61 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 62 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 63 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 64 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 65 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 66 | 2833043393 | Blattabacterium clevelandi CCLhc | Isolate | Cryptocercidae |
| 67 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 68 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 69 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 70 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 71 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 72 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 73 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 74 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 75 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466715_045203 | 3300042616 | Bacteria | 21834 |
| 2 | Ga0466715_440169 | 3300042616 | Bacteria | 7303 |
| 3 | Ga0466726_097429 | 3300042619 | Bacteria | 22374 |
| 4 | Ga0466728_018673 | 3300042620 | Bacteria | 22808 |
| 5 | Ga0466691_045847 | 3300042593 | Bacteria | 49393 |
| 6 | Ga0466696_010556 | 3300042596 | Bacteria | 2729 |
| 7 | Ga0466696_178778 | 3300042596 | Bacteria | 1756 |
| 8 | Ga0123355_10080321 | 3300009826 | Bacteria | 5207 |
| 9 | Ga0123353_10016319 | 3300010167 | Bacteria | 10850 |
| 10 | Ga0466706_236050 | 3300042599 | Bacteria | 32404 |
| 11 | Ga0466714_072876 | 3300042603 | Bacteria | 1616 |
| 12 | Ga0466719_443180 | 3300042606 | Bacteria | 2338 |
| 13 | Ga0466721_173860 | 3300042608 | Bacteria | 22162 |
| 14 | Ga0466722_117304 | 3300042609 | Bacteria | 122884 |
| 15 | Ga0466698_307944 | 3300042610 | Bacteria | 2112 |
| 16 | JGI24699J35502_11133946 | 3300002509 | Bacteria | 20622 |
| 17 | Ga0072940_1003431 | 3300005200 | Bacteria | 3021 |
| 18 | Ga0103263_102158 | 3300007042 | Bacteria | 2453 |
| 19 | Ga0466735_172839 | 3300042624 | Bacteria | 1304 |
| 20 | Ga0466704_314578 | 3300042643 | Bacteria | 8342 |
| 21 | Ga0466709_170238 | 3300042648 | Bacteria | 55916 |
| 22 | Ga0466709_406939 | 3300042648 | Bacteria | 144693 |
| 23 | Ga0466705_110389 | 3300042612 | Bacteria | 3840 |
| 24 | Ga0466732_156366 | 3300042656 | Bacteria | 1939 |
| 25 | Ga0466733_059158 | 3300042659 | Bacteria | 4678 |
| 26 | Ga0466715_010528 | 3300042616 | Bacteria | 7838 |
| 27 | Ga0466723_027283 | 3300042618 | Bacteria | 8488 |
| 28 | Ga0466723_068064 | 3300042618 | Bacteria | 4624 |
| 29 | Ga0466723_373256 | 3300042618 | Bacteria | 33738 |
| 30 | Ga0466729_092228 | 3300042621 | Bacteria | 17697 |
| 31 | Ga0466690_156459 | 3300042590 | Bacteria | 1875 |
| 32 | Ga0466690_264733 | 3300042590 | Bacteria | 2760 |
| 33 | Ga0466692_064596 | 3300042591 | Bacteria | 24215 |
| 34 | Ga0466696_007662 | 3300042596 | Bacteria | 4151 |
| 35 | Ga0466696_236491 | 3300042596 | Bacteria | 25393 |
| 36 | Ga0466696_240820 | 3300042596 | Bacteria | 2280 |
| 37 | Ga0466700_283150 | 3300042600 | Bacteria | 1374 |
| 38 | Ga0466713_124336 | 3300042602 | Bacteria | 24023 |
| 39 | Ga0466717_080546 | 3300042604 | Bacteria | 2192 |
| 40 | Ga0466720_191458 | 3300042607 | Bacteria | 1011 |
| 41 | Ga0466722_162082 | 3300042609 | Bacteria | 2614 |
| 42 | Ga0466698_395311 | 3300042610 | Bacteria | 3177 |
| 43 | Ga0068305_10036641 | 3300005083 | Unclassified | 2823 |
| 44 | Ga0072941_1250626 | 3300005201 | Bacteria | 4209 |
| 45 | Ga0466708_135787 | 3300042652 | Bacteria | 29737 |
| 46 | Ga0466705_019476 | 3300042612 | Bacteria | 24974 |
| 47 | Ga0466705_038128 | 3300042612 | Bacteria | 49408 |
| 48 | Ga0466712_180312 | 3300042614 | Bacteria | 2900 |
| 49 | Ga0466718_143354 | 3300042617 | Bacteria | 1535 |
| 50 | Ga0466723_058528 | 3300042618 | Bacteria | 28595 |
| 51 | Ga0466657_374169 | 3300042582 | Bacteria | 8157 |
| 52 | Ga0466693_216672 | 3300042592 | Bacteria | 7681 |
| 53 | Ga0466691_204814 | 3300042593 | Bacteria | 23707 |
| 54 | Ga0466694_300449 | 3300042594 | Bacteria | 1200 |
| 55 | Ga0466695_394828 | 3300042595 | Bacteria | 6915 |
| 56 | Ga0123356_10264351 | 3300010049 | Bacteria | 1806 |
| 57 | Ga0123353_10106017 | 3300010167 | Bacteria | 4529 |
| 58 | Ga0466701_034352 | 3300042598 | Bacteria | 2625 |
| 59 | Ga0466706_090328 | 3300042599 | Bacteria | 2301 |
| 60 | Ga0466706_123047 | 3300042599 | Bacteria | 432554 |
| 61 | Ga0466706_177219 | 3300042599 | Bacteria | 25525 |
| 62 | Ga0466706_191825 | 3300042599 | Bacteria | 26014 |
| 63 | Ga0466707_152952 | 3300042601 | Bacteria | 15357 |
| 64 | Ga0466714_059082 | 3300042603 | Bacteria | 46712 |
| 65 | Ga0466714_096666 | 3300042603 | Bacteria | 172614 |
| 66 | Ga0466716_483438 | 3300042605 | Bacteria | 16673 |
| 67 | Ga0466722_111573 | 3300042609 | Bacteria | 76934 |
| 68 | Ga0466722_161726 | 3300042609 | Bacteria | 14778 |
| 69 | Ga0466722_261327 | 3300042609 | Bacteria | 19029 |
| 70 | Ga0466698_042429 | 3300042610 | Bacteria | 2730 |
| 71 | JGI24696J40584_12948958 | 3300002834 | Bacteria | 2039 |
| 72 | Ga0104045_1004465 | 3300007085 | Bacteria | 6235 |
| 73 | Ga0466703_019525 | 3300042636 | Bacteria | 29012 |
| 74 | Ga0466705_120439 | 3300042612 | Bacteria | 13186 |
| 75 | Ga0466732_086001 | 3300042656 | Unclassified | 3914 |
| 76 | Ga0466711_067172 | 3300042615 | Bacteria | 5964 |
| 77 | Ga0466715_275548 | 3300042616 | Bacteria | 29682 |
| 78 | Ga0466728_095308 | 3300042620 | Bacteria | 23599 |
| 79 | Ga0466656_181321 | 3300042550 | Bacteria | 1273 |
| 80 | Ga0466690_170288 | 3300042590 | Bacteria | 25098 |
| 81 | Ga0466690_213076 | 3300042590 | Unclassified | 1823 |
| 82 | Ga0466695_019243 | 3300042595 | Bacteria | 4125 |
| 83 | Ga0123356_10062394 | 3300010049 | Bacteria | 3482 |
| 84 | Ga0466706_064416 | 3300042599 | Bacteria | 22081 |
| 85 | Ga0466706_098228 | 3300042599 | Bacteria | 39742 |
| 86 | Ga0466713_052484 | 3300042602 | Bacteria | 51192 |
| 87 | Ga0466719_046124 | 3300042606 | Bacteria | 1193 |
| 88 | Ga0466719_218070 | 3300042606 | Bacteria | 19356 |
| 89 | Ga0466698_273829 | 3300042610 | Bacteria | 4454 |
| 90 | JGI24702J35022_10002652 | 3300002462 | Bacteria | 10856 |
| 91 | Ga0104045_1006984 | 3300007085 | Bacteria | 4943 |
| 92 | Ga0104050_1202867 | 3300007153 | Bacteria | 1550 |
| 93 | Ga0466703_329084 | 3300042636 | Bacteria | 2389 |
| 94 | Ga0466709_129864 | 3300042648 | Bacteria | 7160 |
| 95 | Ga0466708_318539 | 3300042652 | Bacteria | 12389 |
| 96 | Ga0466705_403255 | 3300042612 | Bacteria | 37741 |
| 97 | Ga0466705_502503 | 3300042612 | Bacteria | 16070 |
| 98 | Ga0466711_007105 | 3300042615 | Bacteria | 19648 |
| 99 | Ga0466711_298353 | 3300042615 | Bacteria | 9138 |
| 100 | Ga0466715_111912 | 3300042616 | Bacteria | 7419 |
| 101 | Ga0466715_209992 | 3300042616 | Bacteria | 7477 |
| 102 | Ga0466715_332518 | 3300042616 | Bacteria | 5922 |
| 103 | Ga0466723_093881 | 3300042618 | Bacteria | 35007 |
| 104 | Ga0466728_183323 | 3300042620 | Bacteria | 3927 |
| 105 | Ga0466690_039821 | 3300042590 | Bacteria | 16431 |
| 106 | Ga0466690_147457 | 3300042590 | Bacteria | 20788 |
| 107 | Ga0466690_214016 | 3300042590 | Unclassified | 1821 |
| 108 | Ga0466692_149579 | 3300042591 | Bacteria | 83669 |
| 109 | Ga0466696_053373 | 3300042596 | Bacteria | 10309 |
| 110 | Ga0123356_10054982 | 3300010049 | Bacteria | 3707 |
| 111 | Ga0123353_10293705 | 3300010167 | Bacteria | 2486 |
| 112 | Ga0123353_10443409 | 3300010167 | Bacteria | 1914 |
| 113 | Ga0466716_335360 | 3300042605 | Bacteria | 11224 |
| 114 | Ga0466719_165224 | 3300042606 | Unclassified | 2338 |
| 115 | Ga0466722_253703 | 3300042609 | Bacteria | 9188 |
| 116 | IMNBL1DRAFT_c0010046 | 3300000062 | Bacteria | 4586 |
| 117 | JGI24695J34938_10016383 | 3300002450 | Bacteria | 3770 |
| 118 | Ga0072941_1046885 | 3300005201 | Bacteria | 15179 |
| 119 | Ga0105524_109760 | 3300007733 | Bacteria | 1083 |
| 120 | Ga0466703_072314 | 3300042636 | Bacteria | 2818 |
| 121 | Ga0466704_415186 | 3300042643 | Bacteria | 17633 |
| 122 | Ga0466732_403422 | 3300042656 | Bacteria | 3187 |
| 123 | Ga0466710_347434 | 3300042613 | Bacteria | 1731 |
| 124 | Ga0466711_258871 | 3300042615 | Bacteria | 4796 |
| 125 | Ga0466718_068613 | 3300042617 | Unclassified | 1206 |
| 126 | Ga0466726_223668 | 3300042619 | Bacteria | 1646 |
| 127 | Ga0160432_100014 | 3300012818 | Bacteria | 330009 |
| 128 | Ga0466656_026647 | 3300042550 | Bacteria | 3538 |
| 129 | Ga0466657_388915 | 3300042582 | Bacteria | 3645 |
| 130 | Ga0466691_090834 | 3300042593 | Unclassified | 1081 |
| 131 | Ga0466694_119686 | 3300042594 | Bacteria | 2733 |
| 132 | Ga0466696_283587 | 3300042596 | Bacteria | 7206 |
| 133 | Ga0123353_10152434 | 3300010167 | Bacteria | 3688 |
| 134 | Ga0466717_242123 | 3300042604 | Bacteria | 1087 |
| 135 | Ga0466717_255735 | 3300042604 | Bacteria | 4005 |
| 136 | Ga0466716_248006 | 3300042605 | Bacteria | 34292 |
| 137 | Ga0466719_191213 | 3300042606 | Unclassified | 1193 |
| 138 | JGI24702J35022_10164991 | 3300002462 | Bacteria | 1250 |
| 139 | Ga0072940_1216149 | 3300005200 | Bacteria | 2421 |
| 140 | Ga0104045_1006616 | 3300007085 | Bacteria | 5711 |
| 141 | Ga0466704_601523 | 3300042643 | Bacteria | 55044 |
| 142 | Ga0466709_060190 | 3300042648 | Bacteria | 23292 |
| 143 | Ga0466725_008954 | 3300042654 | Bacteria | 7244 |
| 144 | Ga0466727_139534 | 3300042655 | Bacteria | 7590 |
| 145 | Ga0466705_100884 | 3300042612 | Bacteria | 2534 |
| 146 | Ga0466733_028819 | 3300042659 | Bacteria | 27870 |
| 147 | Ga0466733_122413 | 3300042659 | Bacteria | 26318 |
| 148 | Ga0466711_169486 | 3300042615 | Bacteria | 18240 |
| 149 | Ga0466723_114834 | 3300042618 | Unclassified | 1096 |
| 150 | Ga0466723_178800 | 3300042618 | Bacteria | 21394 |
| 151 | Ga0466723_265810 | 3300042618 | Bacteria | 5328 |
| 152 | Ga0466728_047510 | 3300042620 | Bacteria | 7303 |
| 153 | Ga0264413_148151 | 3300024493 | Bacteria | 2089 |
| 154 | Ga0466690_113891 | 3300042590 | Bacteria | 10267 |
| 155 | Ga0466693_068969 | 3300042592 | Bacteria | 6191 |
| 156 | Ga0466693_206613 | 3300042592 | Bacteria | 1595 |
| 157 | Ga0466691_171488 | 3300042593 | Bacteria | 19589 |
| 158 | Ga0466696_379594 | 3300042596 | Bacteria | 7192 |
| 159 | Ga0466699_054231 | 3300042597 | Bacteria | 7834 |
| 160 | Ga0123354_10067769 | 3300010882 | Bacteria | 5194 |
| 161 | Ga0466706_082645 | 3300042599 | Bacteria | 7494 |
| 162 | Ga0466706_086447 | 3300042599 | Bacteria | 4039 |
| 163 | Ga0466714_169031 | 3300042603 | Bacteria | 152952 |
| 164 | Ga0466716_521649 | 3300042605 | Bacteria | 5807 |
| 165 | JGI24702J35022_10043936 | 3300002462 | Bacteria | 2381 |
| 166 | Ga0068302_10037608 | 3300005071 | Bacteria | 3879 |
| 167 | Ga0104045_1019046 | 3300007085 | Unclassified | 863 |
| 168 | Ga0102740_1000340 | 3300007140 | Bacteria | 13154 |
| 169 | Ga0466735_033998 | 3300042624 | Bacteria | 3762 |
| 170 | Ga0466735_209342 | 3300042624 | Unclassified | 1304 |
| 171 | Ga0466703_241993 | 3300042636 | Bacteria | 19818 |
| 172 | Ga0466709_083357 | 3300042648 | Bacteria | 39489 |
| 173 | Ga0466724_53803 | 3300042649 | Bacteria | 7886 |
| 174 | Ga0466708_076108 | 3300042652 | Bacteria | 112124 |
| 175 | Ga0466708_344198 | 3300042652 | Bacteria | 6384 |
| 176 | Ga0466733_122912 | 3300042659 | Bacteria | 8689 |
| 177 | Ga0466710_453259 | 3300042613 | Bacteria | 4177 |
| 178 | Ga0466711_173254 | 3300042615 | Bacteria | 12508 |
| 179 | Ga0466715_364165 | 3300042616 | Bacteria | 16347 |
| 180 | Ga0466723_174347 | 3300042618 | Bacteria | 9286 |
| 181 | Ga0466728_069680 | 3300042620 | Bacteria | 49538 |
| 182 | Ga0466728_189797 | 3300042620 | Unclassified | 1857 |
| 183 | Ga0466729_037781 | 3300042621 | Bacteria | 19751 |
| 184 | Ga0466656_215471 | 3300042550 | Bacteria | 5868 |
| 185 | Ga0466690_261027 | 3300042590 | Bacteria | 17850 |
| 186 | Ga0466693_346071 | 3300042592 | Bacteria | 1656 |
| 187 | Ga0466691_039529 | 3300042593 | Bacteria | 29822 |
| 188 | Ga0466691_040840 | 3300042593 | Unclassified | 1081 |
| 189 | Ga0466691_059524 | 3300042593 | Bacteria | 5856 |
| 190 | Ga0466691_097612 | 3300042593 | Bacteria | 19663 |
| 191 | Ga0123354_10025356 | 3300010882 | Bacteria | 9348 |
| 192 | Ga0160466_100006 | 3300012809 | Bacteria | 498369 |
| 193 | Ga0466706_183911 | 3300042599 | Bacteria | 19618 |
| 194 | Ga0466707_374739 | 3300042601 | Bacteria | 28797 |
| 195 | Ga0466719_204065 | 3300042606 | Bacteria | 20051 |
| 196 | Ga0466722_033585 | 3300042609 | Bacteria | 11227 |
| 197 | IMNBGM34_c000940 | 3300000036 | Bacteria | 6311 |
| 198 | Ga0072940_1420527 | 3300005200 | Bacteria | 1301 |
| 199 | Ga0104019_1037782 | 3300007150 | Unclassified | 6196 |
| 200 | Ga0466735_224732 | 3300042624 | Bacteria | 2059 |
| 201 | Ga0466702_416767 | 3300042635 | Unclassified | 3172 |
| 202 | Ga0466703_184001 | 3300042636 | Bacteria | 6232 |
| 203 | Ga0466703_193218 | 3300042636 | Bacteria | 3175 |
| 204 | Ga0466708_004425 | 3300042652 | Bacteria | 6512 |
| 205 | Ga0466727_305735 | 3300042655 | Bacteria | 1520 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.