Protein Family IF05584

Metagenome Isolate
122 Members
63 Samples
102 Scaffolds
93.3 Avg Length

🧬 Representative Sequence

ID
3300042599|Ga0466706_052243|Ga0466706_052243_4982_5275
Length
97 aa
Sequence
MAAPQKPQLAVEYTTQLSRDLKKIAKRGLDLGKLTEVLNQLAAQKSLAPRHRDHALAGNYRGTRECHIEPDWLLIYSVSHTDLILAAIRTGSHADLF

πŸ“Š Sample Types

Isolate 16.4%
Metagenome 83.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 41.0%
Unclassified 31.1%
Kalotermitidae 11.5%
Rhinotermitidae 4.9%
Termopsidae 4.9%
Tenebrionidae 3.3%
Hodotermitidae 1.6%
Formicidae 1.6%

🌳 Taxonomy

Archaea 0
Bacteria 111
Eukaryota 0
Viruses 0
Unclassified 11

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2030936001 Nasutitermes corniger hindgut microbial communities from Florida, USA Metagenome Termitidae
2 2758568501 Lactobacillus bombicola ESL0228 Isolate Unclassified
3 2758568502 Lactobacillus bombicola ESL0247 Isolate Unclassified
4 2758568503 Lactobacillus bombicola ESL0246 Isolate Unclassified
5 2778260937 Unclassified Fibrobacteres Co191P3bin40 Isolate Unclassified
6 2820275298 Unclassified Firmicutes Th196P3bin17 Isolate Unclassified
7 2820333861 Unclassified Firmicutes Nt197P3bin72 Isolate Unclassified
8 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
9 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
10 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
11 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
12 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
13 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
14 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
15 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
16 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
17 2820946191 Unclassified Acidobacteria Nt197P3bin31 Isolate Unclassified
18 2820220859 Unclassified Firmicutes Th196P4bin59 Isolate Unclassified
19 2820259584 Unclassified Firmicutes Th196P3bin43 Isolate Unclassified
20 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
21 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
22 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
23 2820008971 Unclassified Synergistetes Lab288P3bin103 Isolate Unclassified
24 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
25 8030347546 Propionimicrobium sp. PCR01-08-3 Isolate Tenebrionidae
26 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
27 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
28 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
29 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
30 2820734335 Unclassified Chloroflexi Lab288P3bin99 Isolate Unclassified
31 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
32 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
33 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
34 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
35 2820696217 Unclassified Firmicutes Co191P1bin66 Isolate Unclassified
36 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
37 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
38 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
39 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
40 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
41 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
42 2820676843 Unclassified Firmicutes Co191P3bin17 Isolate Unclassified
43 2820727601 Unclassified Cloacimonetes Nt197P3bin46 Isolate Unclassified
44 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
45 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
46 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
47 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
48 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
49 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
50 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
51 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
52 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
53 2758568504 Lactobacillus bombicola ESL0245 Isolate Unclassified
54 2820277137 Unclassified Firmicutes Th196P3bin150 Isolate Unclassified
55 2820617402 Unclassified Firmicutes Emb289P1bin131 Isolate Unclassified
56 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
57 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
58 2820947865 Unclassified Acidobacteria Nt197P3bin133 Isolate Unclassified
59 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
60 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
61 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
62 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
63 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466729_082506 3300042621 Bacteria 2882
2 Ga0123357_10335640 3300009784 Bacteria 1470
3 Ga0123355_10638038 3300009826 Bacteria 1248
4 Ga0123355_10916664 3300009826 Bacteria 948
5 Ga0123353_10291181 3300010167 Bacteria 2499
6 Ga0123354_10233394 3300010882 Bacteria 1916
7 Ga0123354_10281903 3300010882 Bacteria 1611
8 Ga0466697_001380 3300042611 Bacteria 1188
9 AustNasuHG_c1021926 3300000089 Bacteria 2060
10 JGI24702J35022_10105535 3300002462 Bacteria 1546
11 Ga0074263_105993 3300005485 Unclassified 1471
12 Ga0466703_300645 3300042636 Bacteria 2482
13 Ga0466733_067249 3300042659 Bacteria 6848
14 Ga0415639_001108 3300038395 Bacteria 18696
15 Ga0415639_018756 3300038395 Bacteria 6501
16 Ga0466694_284309 3300042594 Unclassified 2317
17 Ga0466695_108161 3300042595 Bacteria 1597
18 Ga0466718_138944 3300042617 Bacteria 5385
19 Ga0123357_10096723 3300009784 Bacteria 3823
20 Ga0123355_10000007 3300009826 Bacteria 193006
21 Ga0123355_10591752 3300009826 Bacteria 1321
22 Ga0466706_238331 3300042599 Bacteria 14690
23 Ga0466714_024813 3300042603 Bacteria 7662
24 Ga0466714_119599 3300042603 Bacteria 1574
25 Ga0466719_383103 3300042606 Bacteria 18220
26 Ga0466727_219452 3300042655 Bacteria 1886
27 Ga0123355_11250898 3300009826 Bacteria 751
28 Ga0123355_11745774 3300009826 Bacteria 590
29 Ga0123356_13407732 3300010049 Bacteria 552
30 Ga0123353_10329259 3300010167 Bacteria 2313
31 Ga0123353_11522501 3300010167 Bacteria 850
32 Ga0466717_101231 3300042604 Bacteria 1226
33 Ga0466719_074126 3300042606 Bacteria 1527
34 Ga0466698_082450 3300042610 Bacteria 1074
35 FAAS_10686417 3300001880 Unclassified 526
36 JGI24702J35022_10128570 3300002462 Bacteria 1405
37 Ga0072941_1370848 3300005201 Bacteria 1973
38 Ga0466703_143630 3300042636 Bacteria 1720
39 Ga0466727_329191 3300042655 Bacteria 1649
40 Ga0466733_111826 3300042659 Bacteria 1968
41 Ga0415639_064076 3300038395 Unclassified 1100
42 Ga0466656_325786 3300042550 Bacteria 1811
43 Ga0466692_071202 3300042591 Bacteria 4328
44 Ga0123355_10146768 3300009826 Bacteria 3595
45 Ga0123353_11536455 3300010167 Bacteria 845
46 Ga0466700_426243 3300042600 Bacteria 4552
47 CVPL010L_1001869 3300002932 Bacteria 2843
48 Ga0466731_396058 3300042622 Unclassified 1296
49 Ga0466704_035602 3300042643 Bacteria 2941
50 Ga0466733_189295 3300042659 Bacteria 2536
51 Ga0562375_0486 3300056856 Unclassified 82485
52 Ga0466715_098121 3300042616 Bacteria 2564
53 Ga0466729_171890 3300042621 Bacteria 6821
54 Ga0123355_10445319 3300009826 Bacteria 1636
55 Ga0123355_11850597 3300009826 Unclassified 567
56 Ga0123356_12619167 3300010049 Bacteria 631
57 Ga0123353_10045956 3300010167 Bacteria 6933
58 Ga0123353_12036685 3300010167 Bacteria 702
59 Ga0123353_12158479 3300010167 Bacteria 675
60 Ga0466722_034239 3300042609 Bacteria 1817
61 Ga0466698_202977 3300042610 Bacteria 2919
62 JGI24695J34938_10012564 3300002450 Unclassified 4481
63 Ga0466704_016946 3300042643 Bacteria 1408
64 Ga0466704_177174 3300042643 Bacteria 1731
65 Ga0466691_053252 3300042593 Bacteria 3025
66 Ga0466694_129528 3300042594 Bacteria 1432
67 Ga0466696_203792 3300042596 Bacteria 16887
68 Ga0466711_383178 3300042615 Bacteria 1941
69 Ga0466718_061214 3300042617 Bacteria 19629
70 Ga0123357_10685167 3300009784 Bacteria 742
71 Ga0123356_10645245 3300010049 Bacteria 1226
72 Ga0123353_10957627 3300010167 Bacteria 1157
73 Ga0123354_10660342 3300010882 Bacteria 744
74 Ga0123354_10832502 3300010882 Bacteria 616
75 Ga0466706_052243 3300042599 Bacteria 7851
76 Nasutiter_Contig22729 2030936001 Bacteria 916
77 Ga0466697_100433 3300042611 Bacteria 1351
78 Ga0415639_092071 3300038395 Bacteria 1572
79 Ga0466693_274200 3300042592 Bacteria 2173
80 Ga0466694_055107 3300042594 Bacteria 1144
81 Ga0466726_141892 3300042619 Bacteria 14600
82 Ga0123355_10182470 3300009826 Bacteria 3112
83 Ga0123355_11879271 3300009826 Unclassified 561
84 Ga0123353_12201343 3300010167 Bacteria 667
85 Ga0123353_12405422 3300010167 Bacteria 630
86 Ga0123354_10231026 3300010882 Bacteria 1933
87 JGI24702J35022_10001610 3300002462 Bacteria 13948
88 JGI24702J35022_10021725 3300002462 Bacteria 3478
89 JGI24702J35022_10294487 3300002462 Bacteria 956
90 JGI24703J35330_10760414 3300002501 Bacteria 520
91 Ga0466704_583753 3300042643 Bacteria 5330
92 Ga0466692_085951 3300042591 Bacteria 2367
93 Ga0123356_10200756 3300010049 Bacteria 2033
94 Ga0123356_12824667 3300010049 Bacteria 608
95 Ga0123353_10004674 3300010167 Unclassified 17708
96 Ga0466706_279796 3300042599 Bacteria 1927
97 Ga0466700_110991 3300042600 Bacteria 2382
98 Ga0466721_377220 3300042608 Bacteria 1307
99 AustNasuHG_c1005177 3300000089 Unclassified 4661
100 JGI24695J34938_10000302 3300002450 Bacteria 48715
101 Ga0466697_194096 3300042611 Bacteria 1417
102 Ga0466735_107914 3300042624 Bacteria 1299

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300000089 AustNasuHG_c1005177 AustNasuHG_10051774 76
2 3300042594 Ga0466694_284309 Ga0466694_284309_1131_1361 76
3 3300056856 Ga0562375_0486 Ga0562375_0486_906_1181 84
4 3300009826 Ga0123355_10638038 Ga0123355_106380383 90
5 3300009826 Ga0123355_11250898 Ga0123355_112508982 90
6 3300010882 Ga0123354_10233394 Ga0123354_102333942 90
7 3300042591 Ga0466692_071202 Ga0466692_071202_1840_2112 90
8 3300042591 Ga0466692_085951 Ga0466692_085951_799_1071 90
9 3300042594 Ga0466694_055107 Ga0466694_055107_645_917 90
10 3300042595 Ga0466695_108161 Ga0466695_108161_230_502 90
11 3300042599 Ga0466706_238331 Ga0466706_238331_5454_5726 90
12 3300042603 Ga0466714_024813 Ga0466714_024813_7095_7367 90
13 3300042603 Ga0466714_119599 Ga0466714_119599_873_1145 90
14 3300042610 Ga0466698_202977 Ga0466698_202977_2205_2477 90
15 3300042617 Ga0466718_061214 Ga0466718_061214_7201_7473 90
16 3300042617 Ga0466718_138944 Ga0466718_138944_2001_2273 90
17 3300042636 Ga0466703_300645 Ga0466703_300645_1884_2156 90
18 3300042643 Ga0466704_583753 Ga0466704_583753_4125_4397 90
19 3300042659 Ga0466733_067249 Ga0466733_067249_5803_6075 90
20 iso_pr_bacteria 2820333861 2820334104 90
21 2030936001 Nasutiter_Contig22729 Nasutiterm_1044600 91
22 3300001880 FAAS_10686417 FAAS_106864171 91
23 3300005201 Ga0072941_1370848 Ga0072941_13708482 91
24 3300005485 Ga0074263_105993 Ga0074263_1059933 91
25 3300009784 Ga0123357_10685167 Ga0123357_106851672 91
26 3300009826 Ga0123355_10591752 Ga0123355_105917523 91
27 3300010049 Ga0123356_12619167 Ga0123356_126191672 91
28 3300042596 Ga0466696_203792 Ga0466696_203792_839_1114 91
29 3300042611 Ga0466697_001380 Ga0466697_001380_485_760 91
30 3300042615 Ga0466711_383178 Ga0466711_383178_571_846 91
31 3300042619 Ga0466726_141892 Ga0466726_141892_7718_7993 91
32 3300042624 Ga0466735_107914 Ga0466735_107914_178_453 91
33 3300042636 Ga0466703_143630 Ga0466703_143630_1216_1491 91
34 3300042643 Ga0466704_016946 Ga0466704_016946_1070_1345 91
35 3300042643 Ga0466704_177174 Ga0466704_177174_1198_1473 91
36 3300042655 Ga0466727_329191 Ga0466727_329191_34_309 91
37 3300042659 Ga0466733_189295 Ga0466733_189295_741_1016 91
38 iso_pr_bacteria 8030347546 8030350154 91
39 3300002462 JGI24702J35022_10128570 JGI24702J35022_101285702 92
40 3300002932 CVPL010L_1001869 CVPL010L_10018697 92
41 3300009784 Ga0123357_10096723 Ga0123357_100967232 92
42 3300010882 Ga0123354_10231026 Ga0123354_102310263 92
43 3300042593 Ga0466691_053252 Ga0466691_053252_602_880 92
44 3300042594 Ga0466694_129528 Ga0466694_129528_740_1018 92
45 3300042600 Ga0466700_110991 Ga0466700_110991_118_396 92
46 3300042608 Ga0466721_377220 Ga0466721_377220_819_1097 92
47 3300042616 Ga0466715_098121 Ga0466715_098121_968_1246 92
48 iso_pr_bacteria 2820702360 2820704106 92
49 iso_pr_bacteria 2820727601 2820728690 92
50 iso_pr_bacteria 2820734335 2820735298 92
51 3300000089 AustNasuHG_c1021926 AustNasuHG_10219263 93
52 3300002450 JGI24695J34938_10012564 JGI24695J34938_100125645 93
53 3300009826 Ga0123355_10445319 Ga0123355_104453192 93
54 3300009826 Ga0123355_10916664 Ga0123355_109166642 93
55 3300009826 Ga0123355_11745774 Ga0123355_117457742 93
56 3300010049 Ga0123356_13407732 Ga0123356_134077322 93
57 3300010167 Ga0123353_10004674 Ga0123353_1000467411 93
58 3300010167 Ga0123353_10291181 Ga0123353_102911814 93
59 3300010167 Ga0123353_11522501 Ga0123353_115225012 93
60 3300010167 Ga0123353_12201343 Ga0123353_122013432 93
61 3300038395 Ga0415639_064076 Ga0415639_064076_238_519 93
62 3300042592 Ga0466693_274200 Ga0466693_274200_934_1215 93
63 3300042609 Ga0466722_034239 Ga0466722_034239_764_1045 93
64 3300042622 Ga0466731_396058 Ga0466731_396058_309_590 93
65 3300042655 Ga0466727_219452 Ga0466727_219452_1115_1396 93
66 3300042659 Ga0466733_111826 Ga0466733_111826_333_614 93
67 iso_pr_bacteria 2758568501 2760245092 93
68 iso_pr_bacteria 2758568502 2760246701 93
69 iso_pr_bacteria 2758568503 2760248363 93
70 iso_pr_bacteria 2758568504 2760250024 93
71 3300009826 Ga0123355_11850597 Ga0123355_118505972 94
72 3300009826 Ga0123355_11879271 Ga0123355_118792712 94
73 3300010167 Ga0123353_12158479 Ga0123353_121584792 94
74 3300042611 Ga0466697_194096 Ga0466697_194096_165_449 94
75 3300038395 Ga0415639_001108 Ga0415639_001108_11536_11823 95
76 3300038395 Ga0415639_018756 Ga0415639_018756_2470_2757 95
77 3300038395 Ga0415639_092071 Ga0415639_092071_797_1084 95
78 3300042604 Ga0466717_101231 Ga0466717_101231_422_709 95
79 3300042606 Ga0466719_074126 Ga0466719_074126_773_1060 95
80 3300042606 Ga0466719_383103 Ga0466719_383103_5837_6124 95
81 3300042611 Ga0466697_100433 Ga0466697_100433_88_375 95
82 3300042621 Ga0466729_082506 Ga0466729_082506_1153_1440 95
83 3300042643 Ga0466704_035602 Ga0466704_035602_2305_2592 95
84 iso_pr_bacteria 2778260937 2778347633 95
85 iso_pr_bacteria 2820008971 2820010252 95
86 iso_pr_bacteria 2820220859 2820222743 95
87 iso_pr_bacteria 2820259584 2820261269 95
88 iso_pr_bacteria 2820275298 2820276646 95
89 iso_pr_bacteria 2820277137 2820277529 95
90 iso_pr_bacteria 2820617402 2820617496 95
91 iso_pr_bacteria 2820676843 2820679020 95
92 iso_pr_bacteria 2820696217 2820698510 95
93 iso_pr_bacteria 2820946191 2820947125 95
94 iso_pr_bacteria 2820947865 2820948689 95
95 3300002450 JGI24695J34938_10000302 JGI24695J34938_1000030240 96
96 3300002462 JGI24702J35022_10001610 JGI24702J35022_100016104 96
97 3300002462 JGI24702J35022_10021725 JGI24702J35022_100217255 96
98 3300002462 JGI24702J35022_10294487 JGI24702J35022_102944872 96
99 3300002501 JGI24703J35330_10760414 JGI24703J35330_107604142 96
100 3300009826 Ga0123355_10000007 Ga0123355_1000000793 96
101 3300009826 Ga0123355_10146768 Ga0123355_101467683 96
102 3300009826 Ga0123355_10182470 Ga0123355_101824703 96
103 3300010049 Ga0123356_10200756 Ga0123356_102007563 96
104 3300010049 Ga0123356_10645245 Ga0123356_106452452 96
105 3300010049 Ga0123356_12824667 Ga0123356_128246672 96
106 3300010167 Ga0123353_10045956 Ga0123353_100459566 96
107 3300010167 Ga0123353_11536455 Ga0123353_115364552 96
108 3300010167 Ga0123353_12036685 Ga0123353_120366852 96
109 3300010167 Ga0123353_12405422 Ga0123353_124054221 96
110 3300010882 Ga0123354_10281903 Ga0123354_102819032 96
111 3300010882 Ga0123354_10660342 Ga0123354_106603421 96
112 3300042599 Ga0466706_279796 Ga0466706_279796_804_1094 96
113 3300042599 Ga0466706_052243 Ga0466706_052243_4982_5275 97
114 3300042621 Ga0466729_171890 Ga0466729_171890_2637_2930 97
115 3300009784 Ga0123357_10335640 Ga0123357_103356403 98
116 3300010167 Ga0123353_10957627 Ga0123353_109576273 98
117 3300002462 JGI24702J35022_10105535 JGI24702J35022_101055353 101
118 3300042550 Ga0466656_325786 Ga0466656_325786_1185_1490 101
119 3300042610 Ga0466698_082450 Ga0466698_082450_364_669 101
120 3300010882 Ga0123354_10832502 Ga0123354_108325022 102
121 3300042600 Ga0466700_426243 Ga0466700_426243_457_771 104
122 3300010167 Ga0123353_10329259 Ga0123353_103292592 112

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF15738 YafQ_toxin Bacterial toxin of type II toxin-antitoxin system, YafQ 10 97 0.97
PF05016 ParE_toxin ParE toxin of type II toxin-antitoxin system, parDE 11 96 0.89

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.