Protein Family IF05580
Metagenome
Isolate
184
Members
77
Samples
156
Scaffolds
141.78
Avg Length
Representative Sequence
- ID
- 3300042599|Ga0466706_049413|Ga0466706_049413_1734_2162
- Length
- 142 aa
- Sequence
- MPTINQQQDEIIAEFSDFDDWMDRYQLLIDLGNEQAPLDPQYKTEQNLIEGCQSRVWLQADETPDGTIVFQAESDALIVKGIVALLIRVLSGHTPDEILGADLYFIDRIGLREHLSPTRSNGLLAMVKQMRMYALAFKAKKG
Sample Types
Isolate
15.2%
Metagenome
84.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
32.0%
Termitidae
24.0%
Kalotermitidae
18.7%
Unclassified
6.7%
Rhinotermitidae
4.0%
Termopsidae
4.0%
Passalidae
2.7%
Armadillidiidae
2.7%
Elmidae
1.3%
Formicidae
1.3%
Drosophilidae
1.3%
Hodotermitidae
1.3%
Taxonomy
Archaea
1
Bacteria
181
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 2 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 3 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 4 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 5 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 13 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 14 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 15 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 16 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 17 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 18 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 19 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 20 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 21 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 22 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 23 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 24 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 25 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 26 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 27 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 28 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 29 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 30 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 31 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 32 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 33 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 34 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 35 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 36 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 37 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 38 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 39 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 40 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 41 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 42 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 43 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 44 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 45 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 46 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 47 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 48 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 49 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 50 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 51 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 52 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 53 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 54 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 55 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 56 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 57 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 58 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 59 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 60 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 61 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 62 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 63 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 64 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 65 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 66 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 67 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 68 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 69 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 70 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 71 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 72 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 73 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 74 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 75 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 76 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 77 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_102603 | 3300042659 | Bacteria | 1083 |
| 2 | Ga0123356_10008094 | 3300010049 | Bacteria | 10469 |
| 3 | Ga0123356_12233386 | 3300010049 | Bacteria | 684 |
| 4 | Ga0466656_002043 | 3300042550 | Bacteria | 1477 |
| 5 | Ga0466690_027002 | 3300042590 | Bacteria | 12377 |
| 6 | Ga0466696_014961 | 3300042596 | Bacteria | 77550 |
| 7 | Ga0466696_060564 | 3300042596 | Bacteria | 15490 |
| 8 | Ga0466728_082958 | 3300042620 | Bacteria | 1758 |
| 9 | 2227436347 | 2225789004 | Bacteria | 5525 |
| 10 | IMNBL1DRAFT_c0001032 | 3300000062 | Bacteria | 21563 |
| 11 | JGI24702J35022_10016312 | 3300002462 | Bacteria | 4072 |
| 12 | Ga0068305_10002064 | 3300005083 | Bacteria | 156822 |
| 13 | Ga0466706_242401 | 3300042599 | Bacteria | 7115 |
| 14 | Ga0466700_051149 | 3300042600 | Bacteria | 14467 |
| 15 | Ga0466700_327334 | 3300042600 | Bacteria | 6607 |
| 16 | Ga0466707_042066 | 3300042601 | Bacteria | 33916 |
| 17 | Ga0466707_048206 | 3300042601 | Bacteria | 20502 |
| 18 | Ga0466707_074552 | 3300042601 | Bacteria | 9882 |
| 19 | Ga0466713_020362 | 3300042602 | Bacteria | 2140 |
| 20 | Ga0466713_022249 | 3300042602 | Bacteria | 5612 |
| 21 | Ga0466713_054436 | 3300042602 | Bacteria | 5042 |
| 22 | Ga0466719_146195 | 3300042606 | Bacteria | 9170 |
| 23 | Ga0466734_149966 | 3300042623 | Bacteria | 1529 |
| 24 | Ga0466703_076149 | 3300042636 | Bacteria | 7100 |
| 25 | Ga0466703_116882 | 3300042636 | Bacteria | 19357 |
| 26 | Ga0466709_207018 | 3300042648 | Bacteria | 42287 |
| 27 | Ga0466705_015792 | 3300042612 | Bacteria | 1696 |
| 28 | Ga0466705_387234 | 3300042612 | Unclassified | 2517 |
| 29 | Ga0466693_182448 | 3300042592 | Bacteria | 1340 |
| 30 | Ga0466696_068608 | 3300042596 | Bacteria | 11435 |
| 31 | Ga0466715_128031 | 3300042616 | Bacteria | 13792 |
| 32 | Ga0466715_405993 | 3300042616 | Bacteria | 2479 |
| 33 | JGI24702J35022_10147750 | 3300002462 | Bacteria | 1316 |
| 34 | Ga0068305_10028206 | 3300005083 | Bacteria | 9775 |
| 35 | Ga0068305_10258562 | 3300005083 | Bacteria | 2524 |
| 36 | Ga0072941_1630303 | 3300005201 | Bacteria | 2915 |
| 37 | Ga0466706_012196 | 3300042599 | Bacteria | 6835 |
| 38 | Ga0466706_153678 | 3300042599 | Unclassified | 4958 |
| 39 | Ga0466707_282164 | 3300042601 | Bacteria | 1329 |
| 40 | Ga0466713_095333 | 3300042602 | Bacteria | 7204 |
| 41 | Ga0466713_130834 | 3300042602 | Bacteria | 31381 |
| 42 | Ga0466716_120561 | 3300042605 | Bacteria | 8833 |
| 43 | Ga0466716_327739 | 3300042605 | Bacteria | 1182 |
| 44 | Ga0466719_148955 | 3300042606 | Bacteria | 4231 |
| 45 | Ga0466722_263219 | 3300042609 | Bacteria | 3160 |
| 46 | Ga0466734_149046 | 3300042623 | Bacteria | 1462 |
| 47 | Ga0466735_046740 | 3300042624 | Bacteria | 2183 |
| 48 | Ga0466735_215593 | 3300042624 | Bacteria | 1022 |
| 49 | Ga0466703_264743 | 3300042636 | Bacteria | 19401 |
| 50 | Ga0466704_125583 | 3300042643 | Bacteria | 27979 |
| 51 | Ga0466704_554600 | 3300042643 | Bacteria | 11294 |
| 52 | Ga0466705_173968 | 3300042612 | Bacteria | 9238 |
| 53 | Ga0123356_11279403 | 3300010049 | Bacteria | 897 |
| 54 | Ga0466690_004552 | 3300042590 | Bacteria | 6148 |
| 55 | Ga0466696_319649 | 3300042596 | Bacteria | 12317 |
| 56 | Ga0466723_100368 | 3300042618 | Bacteria | 1324 |
| 57 | Ga0466726_024142 | 3300042619 | Bacteria | 22843 |
| 58 | Ga0072941_1014371 | 3300005201 | Bacteria | 1524 |
| 59 | Ga0466706_020667 | 3300042599 | Bacteria | 1712 |
| 60 | Ga0466706_106820 | 3300042599 | Bacteria | 11486 |
| 61 | Ga0466713_098438 | 3300042602 | Bacteria | 8563 |
| 62 | Ga0466719_428564 | 3300042606 | Bacteria | 11764 |
| 63 | Ga0466698_295370 | 3300042610 | Bacteria | 1136 |
| 64 | Ga0466734_031042 | 3300042623 | Bacteria | 1177 |
| 65 | Ga0466735_124772 | 3300042624 | Bacteria | 3791 |
| 66 | Ga0466709_148866 | 3300042648 | Bacteria | 12054 |
| 67 | Ga0466727_196622 | 3300042655 | Bacteria | 2588 |
| 68 | Ga0466705_242001 | 3300042612 | Bacteria | 3768 |
| 69 | Ga0123357_10025110 | 3300009784 | Bacteria | 8033 |
| 70 | Ga0123356_10339926 | 3300010049 | Bacteria | 1621 |
| 71 | Ga0160457_1004931 | 3300012858 | Bacteria | 2078 |
| 72 | Ga0466691_036107 | 3300042593 | Bacteria | 11902 |
| 73 | Ga0466696_175775 | 3300042596 | Bacteria | 6320 |
| 74 | Ga0466728_127567 | 3300042620 | Bacteria | 1100 |
| 75 | JGI24699J35502_11133870 | 3300002509 | Bacteria | 17629 |
| 76 | JGI24696J40584_12416047 | 3300002834 | Bacteria | 561 |
| 77 | Ga0466706_046564 | 3300042599 | Bacteria | 2178 |
| 78 | Ga0466706_109717 | 3300042599 | Bacteria | 38259 |
| 79 | Ga0466706_144986 | 3300042599 | Bacteria | 14894 |
| 80 | Ga0466706_239987 | 3300042599 | Bacteria | 1925 |
| 81 | Ga0466706_249816 | 3300042599 | Bacteria | 12942 |
| 82 | Ga0466707_221316 | 3300042601 | Bacteria | 4674 |
| 83 | Ga0466707_237717 | 3300042601 | Bacteria | 21796 |
| 84 | Ga0466707_399872 | 3300042601 | Bacteria | 25092 |
| 85 | Ga0466716_359991 | 3300042605 | Bacteria | 1905 |
| 86 | Ga0466719_070992 | 3300042606 | Bacteria | 21195 |
| 87 | Ga0466735_055144 | 3300042624 | Bacteria | 1814 |
| 88 | Ga0466735_067070 | 3300042624 | Bacteria | 4663 |
| 89 | Ga0466735_082084 | 3300042624 | Bacteria | 3045 |
| 90 | Ga0466704_338740 | 3300042643 | Bacteria | 1126 |
| 91 | Ga0466709_033872 | 3300042648 | Bacteria | 15123 |
| 92 | Ga0466727_247918 | 3300042655 | Bacteria | 10698 |
| 93 | Ga0466697_251672 | 3300042611 | Bacteria | 1160 |
| 94 | Ga0466733_038286 | 3300042659 | Bacteria | 266317 |
| 95 | Ga0466656_020661 | 3300042550 | Bacteria | 5276 |
| 96 | Ga0466691_091359 | 3300042593 | Bacteria | 169365 |
| 97 | Ga0466710_410632 | 3300042613 | Bacteria | 1588 |
| 98 | Ga0466711_264721 | 3300042615 | Bacteria | 26624 |
| 99 | Ga0466715_309209 | 3300042616 | Bacteria | 44379 |
| 100 | Ga0466723_203812 | 3300042618 | Bacteria | 4824 |
| 101 | IMNBL1DRAFT_c0020149 | 3300000062 | Bacteria | 2709 |
| 102 | Ga0068305_10111749 | 3300005083 | Bacteria | 2628 |
| 103 | Ga0104041_1034016 | 3300007106 | Bacteria | 1114 |
| 104 | Ga0466706_049413 | 3300042599 | Bacteria | 18222 |
| 105 | Ga0466707_094550 | 3300042601 | Bacteria | 1302 |
| 106 | Ga0466713_048382 | 3300042602 | Bacteria | 34052 |
| 107 | Ga0466735_061198 | 3300042624 | Bacteria | 8328 |
| 108 | Ga0466735_133056 | 3300042624 | Bacteria | 5271 |
| 109 | Ga0466725_163341 | 3300042654 | Bacteria | 17426 |
| 110 | Ga0466727_290245 | 3300042655 | Bacteria | 1717 |
| 111 | Ga0466705_372873 | 3300042612 | Bacteria | 2926 |
| 112 | Ga0160469_103519 | 3300012824 | Bacteria | 2132 |
| 113 | Ga0265387_1138588 | 3300024582 | Bacteria | 540 |
| 114 | Ga0466690_036554 | 3300042590 | Bacteria | 8294 |
| 115 | Ga0466692_118396 | 3300042591 | Bacteria | 17383 |
| 116 | Ga0466692_159828 | 3300042591 | Bacteria | 1510 |
| 117 | Ga0466711_338262 | 3300042615 | Bacteria | 2533 |
| 118 | Ga0466715_161819 | 3300042616 | Bacteria | 3799 |
| 119 | Ga0466715_281872 | 3300042616 | Bacteria | 2886 |
| 120 | Ga0466728_240734 | 3300042620 | Bacteria | 10927 |
| 121 | Ga0102740_1004361 | 3300007140 | Bacteria | 2822 |
| 122 | Ga0466706_222855 | 3300042599 | Bacteria | 3119 |
| 123 | Ga0466706_257671 | 3300042599 | Bacteria | 22850 |
| 124 | Ga0466707_240433 | 3300042601 | Bacteria | 1542 |
| 125 | Ga0466734_154017 | 3300042623 | Bacteria | 1775 |
| 126 | Ga0466735_153438 | 3300042624 | Bacteria | 10285 |
| 127 | Ga0466703_001080 | 3300042636 | Bacteria | 3254 |
| 128 | Ga0466704_096242 | 3300042643 | Bacteria | 7229 |
| 129 | Ga0466708_292277 | 3300042652 | Bacteria | 30652 |
| 130 | Ga0466705_050950 | 3300042612 | Bacteria | 13509 |
| 131 | Ga0123356_12183752 | 3300010049 | Archaea | 692 |
| 132 | Ga0123354_10031632 | 3300010882 | Bacteria | 8298 |
| 133 | Ga0466692_032866 | 3300042591 | Bacteria | 37963 |
| 134 | Ga0466723_108832 | 3300042618 | Bacteria | 7789 |
| 135 | Ga0466728_098945 | 3300042620 | Bacteria | 3978 |
| 136 | Ga0466701_050869 | 3300042598 | Bacteria | 17554 |
| 137 | Ga0466706_041421 | 3300042599 | Bacteria | 6658 |
| 138 | Ga0466706_166563 | 3300042599 | Bacteria | 29380 |
| 139 | Ga0466707_071134 | 3300042601 | Bacteria | 13094 |
| 140 | Ga0466707_130524 | 3300042601 | Bacteria | 6372 |
| 141 | Ga0466713_101553 | 3300042602 | Bacteria | 8041 |
| 142 | Ga0466714_062274 | 3300042603 | Bacteria | 5640 |
| 143 | Ga0466722_035273 | 3300042609 | Bacteria | 4272 |
| 144 | Ga0466722_084732 | 3300042609 | Bacteria | 2145 |
| 145 | Ga0466735_103100 | 3300042624 | Bacteria | 5686 |
| 146 | Ga0466735_108542 | 3300042624 | Bacteria | 12812 |
| 147 | Ga0466735_197679 | 3300042624 | Bacteria | 1448 |
| 148 | Ga0466705_005625 | 3300042612 | Bacteria | 36078 |
| 149 | Ga0466710_297519 | 3300042613 | Bacteria | 2193 |
| 150 | IMNBL1DRAFT_c0000100 | 3300000062 | Bacteria | 75970 |
| 151 | Ga0466706_021030 | 3300042599 | Bacteria | 4406 |
| 152 | Ga0466707_044398 | 3300042601 | Bacteria | 37204 |
| 153 | Ga0466716_043611 | 3300042605 | Bacteria | 1496 |
| 154 | Ga0466716_487732 | 3300042605 | Bacteria | 16500 |
| 155 | Ga0466731_008464 | 3300042622 | Bacteria | 2300 |
| 156 | Ga0466727_165334 | 3300042655 | Bacteria | 3349 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02657 | SufE | Fe-S metabolism associated domain | 13 | 132 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.