Protein Family IF05552
Metagenome
Isolate
173
Members
68
Samples
155
Scaffolds
136.49
Avg Length
Representative Sequence
- ID
- 3300042599|Ga0466706_004369|Ga0466706_004369_6519_7019
- Length
- 166 aa
- Sequence
- LKKNFSIQREISSFAEFLEAPMRLLQYLIKNSMKISHIEHLGIAVKSIEEALPYYENVLGLKCYNIEVVEDQKVKTAFLKVGETKIELLEPTSPDSTIAKFIENKGIGVHHVAFAVEDGVAHALAEAEAAGLRLIDKAPRGGAEGLHIAFLHPKSTQGILTELCEC
Sample Types
Isolate
10.4%
Metagenome
89.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.9%
Blattidae
18.2%
Kalotermitidae
15.2%
Unclassified
9.1%
Rhinotermitidae
6.1%
Termopsidae
6.1%
Passalidae
3.0%
Elmidae
1.5%
Culicidae
1.5%
Hodotermitidae
1.5%
Taxonomy
Archaea
0
Bacteria
155
Eukaryota
0
Viruses
0
Unclassified
18
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864816158 | Priestia aryabhattai S00060 | Isolate | Elmidae |
| 2 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 3 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 4 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 5 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 6 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 7 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 8 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 9 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 10 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 11 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 12 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 13 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 14 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 15 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 16 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 17 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 18 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 19 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 20 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 21 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 22 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 23 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 24 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 25 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 26 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 27 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 28 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 29 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 30 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 31 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 32 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 33 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 34 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 35 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 36 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 37 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 38 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 39 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 40 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 41 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 42 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 43 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 44 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 45 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 46 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 47 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 48 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 49 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 50 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 51 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 52 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 53 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 54 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 55 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 56 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 57 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 58 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 59 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 60 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 61 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 62 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 63 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 64 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 65 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 66 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 67 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 68 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_179409 | 3300042611 | Bacteria | 152612 |
| 2 | Ga0466732_202853 | 3300042656 | Unclassified | 4280 |
| 3 | Ga0123357_10019000 | 3300009784 | Bacteria | 9146 |
| 4 | Ga0123357_10798867 | 3300009784 | Bacteria | 639 |
| 5 | Ga0123356_11940572 | 3300010049 | Bacteria | 734 |
| 6 | Ga0123356_12861047 | 3300010049 | Bacteria | 604 |
| 7 | Ga0123353_10064926 | 3300010167 | Bacteria | 5859 |
| 8 | Ga0466713_044677 | 3300042602 | Bacteria | 5655 |
| 9 | Ga0466714_111320 | 3300042603 | Bacteria | 185233 |
| 10 | Ga0466716_543592 | 3300042605 | Bacteria | 6099 |
| 11 | Ga0466719_534258 | 3300042606 | Bacteria | 1181 |
| 12 | Ga0466722_173245 | 3300042609 | Bacteria | 25708 |
| 13 | Ga0466693_395878 | 3300042592 | Bacteria | 1711 |
| 14 | Ga0466695_276187 | 3300042595 | Bacteria | 5537 |
| 15 | Ga0466731_433533 | 3300042622 | Bacteria | 2304 |
| 16 | Ga0466735_144685 | 3300042624 | Bacteria | 4891 |
| 17 | Ga0466735_177777 | 3300042624 | Bacteria | 1432 |
| 18 | Ga0466725_171567 | 3300042654 | Bacteria | 4853 |
| 19 | Ga0072940_1042745 | 3300005200 | Unclassified | 3049 |
| 20 | Ga0466705_352088 | 3300042612 | Bacteria | 8094 |
| 21 | Ga0123356_10483399 | 3300010049 | Bacteria | 1392 |
| 22 | Ga0123353_10186294 | 3300010167 | Unclassified | 3282 |
| 23 | Ga0123354_10000698 | 3300010882 | Bacteria | 35854 |
| 24 | Ga0123354_10001131 | 3300010882 | Bacteria | 31107 |
| 25 | Ga0466701_071474 | 3300042598 | Bacteria | 1180 |
| 26 | Ga0466706_190648 | 3300042599 | Bacteria | 33307 |
| 27 | Ga0466713_018694 | 3300042602 | Bacteria | 10231 |
| 28 | Ga0466713_037701 | 3300042602 | Bacteria | 30244 |
| 29 | Ga0466716_264007 | 3300042605 | Bacteria | 8928 |
| 30 | Ga0466720_005611 | 3300042607 | Bacteria | 10586 |
| 31 | Ga0466697_002956 | 3300042611 | Bacteria | 1323 |
| 32 | Ga0264413_104891 | 3300024493 | Bacteria | 27749 |
| 33 | Ga0466692_097654 | 3300042591 | Bacteria | 22801 |
| 34 | Ga0466696_406941 | 3300042596 | Bacteria | 7315 |
| 35 | Ga0466703_237099 | 3300042636 | Bacteria | 3652 |
| 36 | 2227136354 | 2225789004 | Bacteria | 36851 |
| 37 | IMNBL1DRAFT_c0005251 | 3300000062 | Bacteria | 7473 |
| 38 | Ga0072940_1114970 | 3300005200 | Unclassified | 646 |
| 39 | Ga0123357_10452740 | 3300009784 | Bacteria | 1111 |
| 40 | Ga0123353_10010753 | 3300010167 | Bacteria | 12802 |
| 41 | Ga0123354_10024823 | 3300010882 | Bacteria | 9455 |
| 42 | Ga0466710_409791 | 3300042613 | Bacteria | 1016 |
| 43 | Ga0466715_276082 | 3300042616 | Bacteria | 11278 |
| 44 | Ga0466706_004369 | 3300042599 | Bacteria | 14417 |
| 45 | Ga0466707_144970 | 3300042601 | Bacteria | 107655 |
| 46 | Ga0466707_221131 | 3300042601 | Bacteria | 5314 |
| 47 | Ga0466720_209531 | 3300042607 | Unclassified | 22578 |
| 48 | Ga0466657_192867 | 3300042582 | Bacteria | 1357 |
| 49 | Ga0466694_065656 | 3300042594 | Bacteria | 1099 |
| 50 | Ga0466703_281965 | 3300042636 | Bacteria | 13279 |
| 51 | Ga0466704_067458 | 3300042643 | Bacteria | 7219 |
| 52 | Ga0466725_138512 | 3300042654 | Bacteria | 4998 |
| 53 | AustNasuHG_c1051903 | 3300000089 | Unclassified | 868 |
| 54 | Ga0072940_1053712 | 3300005200 | Bacteria | 1287 |
| 55 | Ga0123357_10211905 | 3300009784 | Unclassified | 2174 |
| 56 | Ga0123356_11322936 | 3300010049 | Unclassified | 883 |
| 57 | Ga0466710_218346 | 3300042613 | Bacteria | 25228 |
| 58 | Ga0466710_267097 | 3300042613 | Bacteria | 6816 |
| 59 | Ga0466715_360583 | 3300042616 | Bacteria | 13693 |
| 60 | Ga0466726_219671 | 3300042619 | Bacteria | 11008 |
| 61 | Ga0466701_080914 | 3300042598 | Bacteria | 13123 |
| 62 | Ga0466706_162711 | 3300042599 | Bacteria | 1662 |
| 63 | Ga0466706_286831 | 3300042599 | Bacteria | 9761 |
| 64 | Ga0466722_016895 | 3300042609 | Bacteria | 27981 |
| 65 | Ga0466656_382376 | 3300042550 | Bacteria | 1144 |
| 66 | Ga0466657_232886 | 3300042582 | Bacteria | 11540 |
| 67 | Ga0466692_203956 | 3300042591 | Bacteria | 75716 |
| 68 | Ga0466729_251669 | 3300042621 | Bacteria | 1267 |
| 69 | Ga0466735_153195 | 3300042624 | Bacteria | 16596 |
| 70 | Ga0466702_144965 | 3300042635 | Unclassified | 1169 |
| 71 | Ga0466702_459953 | 3300042635 | Unclassified | 2228 |
| 72 | Ga0466727_023034 | 3300042655 | Bacteria | 15116 |
| 73 | JGI24702J35022_10003763 | 3300002462 | Bacteria | 9117 |
| 74 | Ga0072940_1262232 | 3300005200 | Bacteria | 599 |
| 75 | Ga0123353_10026027 | 3300010167 | Bacteria | 8926 |
| 76 | Ga0123353_10376147 | 3300010167 | Bacteria | 2127 |
| 77 | Ga0466726_038587 | 3300042619 | Bacteria | 2354 |
| 78 | Ga0466726_156882 | 3300042619 | Bacteria | 1572 |
| 79 | Ga0466701_064864 | 3300042598 | Bacteria | 7389 |
| 80 | Ga0466706_155784 | 3300042599 | Bacteria | 2120 |
| 81 | Ga0466706_193207 | 3300042599 | Bacteria | 16521 |
| 82 | Ga0466707_197654 | 3300042601 | Bacteria | 17204 |
| 83 | Ga0466716_381761 | 3300042605 | Unclassified | 2127 |
| 84 | Ga0466720_017295 | 3300042607 | Bacteria | 17523 |
| 85 | Ga0466722_043134 | 3300042609 | Bacteria | 89421 |
| 86 | Ga0466657_329185 | 3300042582 | Bacteria | 2801 |
| 87 | Ga0466690_161857 | 3300042590 | Bacteria | 15085 |
| 88 | Ga0466692_011631 | 3300042591 | Bacteria | 1998 |
| 89 | Ga0466696_057701 | 3300042596 | Bacteria | 9240 |
| 90 | Ga0466696_098197 | 3300042596 | Bacteria | 9966 |
| 91 | Ga0466701_006486 | 3300042598 | Bacteria | 75449 |
| 92 | Ga0466730_049885 | 3300042625 | Bacteria | 4422 |
| 93 | Ga0466702_314865 | 3300042635 | Unclassified | 1113 |
| 94 | Ga0466704_020179 | 3300042643 | Bacteria | 18471 |
| 95 | Ga0466709_014514 | 3300042648 | Bacteria | 492815 |
| 96 | Ga0466709_163478 | 3300042648 | Bacteria | 96467 |
| 97 | Ga0466727_184001 | 3300042655 | Bacteria | 2716 |
| 98 | Ga0466727_197880 | 3300042655 | Bacteria | 1419 |
| 99 | 2227091955 | 2225789004 | Bacteria | 1831 |
| 100 | AustNasuHG_c1006123 | 3300000089 | Bacteria | 4299 |
| 101 | JGI24702J35022_10060689 | 3300002462 | Bacteria | 2022 |
| 102 | Ga0068302_10087038 | 3300005071 | Bacteria | 10777 |
| 103 | Ga0466733_080869 | 3300042659 | Bacteria | 63970 |
| 104 | Ga0466733_119838 | 3300042659 | Unclassified | 3670 |
| 105 | Ga0466733_180980 | 3300042659 | Bacteria | 8512 |
| 106 | Ga0123353_10145640 | 3300010167 | Bacteria | 3788 |
| 107 | Ga0123353_10604427 | 3300010167 | Bacteria | 1566 |
| 108 | Ga0466711_313190 | 3300042615 | Bacteria | 2296 |
| 109 | Ga0466706_194383 | 3300042599 | Bacteria | 20630 |
| 110 | Ga0466706_252393 | 3300042599 | Bacteria | 20742 |
| 111 | Ga0466706_283269 | 3300042599 | Bacteria | 44776 |
| 112 | Ga0466707_048653 | 3300042601 | Bacteria | 5314 |
| 113 | Ga0466713_083606 | 3300042602 | Bacteria | 82045 |
| 114 | Ga0466690_305789 | 3300042590 | Bacteria | 21200 |
| 115 | Ga0466696_080281 | 3300042596 | Bacteria | 3750 |
| 116 | Ga0466704_453371 | 3300042643 | Bacteria | 3076 |
| 117 | Ga0466704_460981 | 3300042643 | Bacteria | 4350 |
| 118 | 2227505586 | 2225789004 | Bacteria | 721 |
| 119 | 2227543252 | 2225789004 | Unclassified | 2958 |
| 120 | JGI24702J35022_10027276 | 3300002462 | Bacteria | 3073 |
| 121 | JGI24696J40584_12808878 | 3300002834 | Bacteria | 884 |
| 122 | Ga0466705_215218 | 3300042612 | Bacteria | 22230 |
| 123 | Ga0466711_011452 | 3300042615 | Bacteria | 15190 |
| 124 | Ga0466718_045929 | 3300042617 | Bacteria | 1412 |
| 125 | Ga0466707_198141 | 3300042601 | Bacteria | 1288 |
| 126 | Ga0466713_010899 | 3300042602 | Bacteria | 25756 |
| 127 | Ga0466713_132246 | 3300042602 | Bacteria | 10294 |
| 128 | Ga0466713_132708 | 3300042602 | Unclassified | 6769 |
| 129 | Ga0160435_1007579 | 3300012857 | Bacteria | 2364 |
| 130 | Ga0466657_393456 | 3300042582 | Unclassified | 7679 |
| 131 | Ga0466692_202682 | 3300042591 | Bacteria | 12181 |
| 132 | Ga0466694_174568 | 3300042594 | Bacteria | 5723 |
| 133 | Ga0466729_246405 | 3300042621 | Bacteria | 1010 |
| 134 | Ga0466735_052126 | 3300042624 | Bacteria | 1669 |
| 135 | Ga0466730_089353 | 3300042625 | Unclassified | 1870 |
| 136 | Ga0466703_338176 | 3300042636 | Bacteria | 6915 |
| 137 | IMNBL1DRAFT_c0000626 | 3300000062 | Bacteria | 28211 |
| 138 | JGI24702J35022_10088522 | 3300002462 | Bacteria | 1683 |
| 139 | JGI24702J35022_10134764 | 3300002462 | Bacteria | 1374 |
| 140 | JGI24696J40584_12826048 | 3300002834 | Bacteria | 919 |
| 141 | Ga0466705_382625 | 3300042612 | Bacteria | 9059 |
| 142 | Ga0466732_252633 | 3300042656 | Bacteria | 1413 |
| 143 | Ga0466733_006222 | 3300042659 | Bacteria | 41230 |
| 144 | Ga0123356_10868759 | 3300010049 | Bacteria | 1073 |
| 145 | Ga0466705_500429 | 3300042612 | Bacteria | 4861 |
| 146 | Ga0466715_064161 | 3300042616 | Bacteria | 33093 |
| 147 | Ga0466718_120045 | 3300042617 | Bacteria | 2830 |
| 148 | Ga0466718_129920 | 3300042617 | Bacteria | 4660 |
| 149 | Ga0466701_088051 | 3300042598 | Bacteria | 17095 |
| 150 | Ga0466706_163906 | 3300042599 | Bacteria | 105365 |
| 151 | Ga0264413_106089 | 3300024493 | Bacteria | 5744 |
| 152 | Ga0265387_1001293 | 3300024582 | Bacteria | 3674 |
| 153 | Ga0466696_019120 | 3300042596 | Bacteria | 4412 |
| 154 | Ga0466703_126789 | 3300042636 | Bacteria | 2371 |
| 155 | Ga0466704_620285 | 3300042643 | Unclassified | 2103 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.