Protein Family IF05509

Metagenome Isolate
183 Members
87 Samples
145 Scaffolds
326.68 Avg Length

🧬 Representative Sequence

ID
3300042598|Ga0466701_073991|Ga0466701_073991_275_1417
Length
380 aa
Sequence
MNNTKKSAGAKLREISKYSDRQIKKYEKLKKRKNIPEHEYLTKMRDENNLVEFDNVCTWFFTDVGTVRAVDGVSFDIPKGKTIGIVGESGCGKSVTSLSLMRLVHAPTGQIVSGEIRYNTGKKAVDITKLPIKEMQKIRGNEIGMIFQEPMTSLNPVFTIGMQIDEAIKLHNPKMTKADVKNRTLEMLDLVGIAEGVRIYKCYPHELSGGMRQRVMIAMTLACDPQLIIADEPTTALDVTIQAQILDLLRGLKDKINASIMLITHDLGVVAEMADYVAVMYAGRIIEKGTAEDIFLNPSHPYTVGLMESKPVVGREVDKLYSIPGNVPNPINLTDNCYFHGRCEKCTDKCAGVYPPLVKLSETHYVACYLYEKSEEAGIK

📊 Sample Types

Isolate 20.8%
Metagenome 79.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 24.4%
Termitidae 18.3%
Kalotermitidae 15.9%
Anthocoridae 13.4%
Drosophilidae 6.1%
Apidae 3.7%
Termopsidae 3.7%
Rhinotermitidae 2.4%
Curculionidae 2.4%
Culicidae 2.4%
Crambidae 1.2%
Formicidae 1.2%
Tephritidae 1.2%
Cerambycidae 1.2%
Daphniidae 1.2%
Hodotermitidae 1.2%

🌳 Taxonomy

Archaea 0
Bacteria 176
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2515154104 Streptomyces sp. KhCrAH-244 Isolate Unclassified
2 2820211246 Unclassified Kiritimatiellaeota Nt197P3bin96 Isolate Unclassified
3 2820719201 Unclassified Fibrobacteres Lab288P3bin119 Isolate Unclassified
4 3004010258 Citrobacter sp. JGM124 Isolate Drosophilidae
5 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
6 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
7 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
8 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
9 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
10 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
11 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
12 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
13 2820344559 Unclassified Firmicutes Nt197P3bin63 Isolate Unclassified
14 2878947168 Serratia marcescens ADJS-2D_White Isolate Unclassified
15 2937735258 Serratia marcescens KZ11 Isolate Apidae
16 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
17 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
18 650716102 Treponema primitia ZAS-2 Isolate Unclassified
19 8004307473 Serratia sp. OLIL2 Isolate Anthocoridae
20 8004571736 Serratia sp. OLDL1 Isolate Anthocoridae
21 8021535516 Klebsiella sp. Kd70 TUC-EEAOC Isolate Crambidae
22 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
23 2781125688 Treponema sp. Lab288P4bin13 Isolate Unclassified
24 2820014844 Unclassified Spirochaetes Nt197P3bin95 Isolate Unclassified
25 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
26 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
27 2978161719 Serratia marcescens KZ2 Isolate Apidae
28 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
29 8021540981 Klebsiella sp. Kpp Isolate Tephritidae
30 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
31 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
32 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
33 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
34 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
35 2922113941 Serratia sp. OLEL1 Isolate Anthocoridae
36 2937751072 Serratia sp. OLMTLW26 Isolate Anthocoridae
37 2965197371 Serratia sp. OLCL1 Isolate Anthocoridae
38 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
39 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
40 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
41 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
42 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
43 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
44 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
45 2820209022 Unclassified Kiritimatiellaeota Th196P3bin76 Isolate Unclassified
46 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
47 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
48 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
49 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
50 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
51 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
52 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
53 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
54 2820312173 Unclassified Firmicutes Nt197P4bin8 Isolate Unclassified
55 2820451402 Unclassified Firmicutes Lab288P3bin174 Isolate Unclassified
56 2847708326 Serratia liquefaciens P2ACOL2 Isolate Cerambycidae
57 2874504452 Serratia marcescens ADJS-2C_Purple Isolate Unclassified
58 2996406003 Serratia sp. OLJL1 Isolate Anthocoridae
59 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
60 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
61 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
62 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
63 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
64 2556921669 Shinella sp. DD12 Isolate Daphniidae
65 2874434233 Serratia marcescens ADJS-2C_Red Isolate Unclassified
66 2961232173 Serratia sp. OLLOLW30 Isolate Anthocoridae
67 2970791725 Serratia sp. OLBL1 Isolate Anthocoridae
68 2996467878 Serratia sp. OLFL2 Isolate Anthocoridae
69 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
70 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
71 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
72 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
73 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
74 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
75 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
76 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
77 2819998259 Unclassified Spirochaetes Nc150P4bin23 Isolate Unclassified
78 2820223845 Unclassified Firmicutes Th196P4bin57 Isolate Unclassified
79 3300005318 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut Metagenome Drosophilidae
80 3300007103 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut Metagenome Drosophilidae
81 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
82 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
83 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
84 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
85 8004285568 Serratia sp. OLHL2 Isolate Anthocoridae
86 8004541719 Serratia marcescens KZ19 Isolate Apidae
87 8004582426 Serratia sp. OSPLW9 Isolate Anthocoridae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_171974 3300042612 Bacteria 5134
2 Ga0466733_124128 3300042659 Bacteria 2305
3 Ga0123355_10058065 3300009826 Bacteria 6261
4 Ga0123353_10004775 3300010167 Bacteria 17577
5 Ga0123353_10020384 3300010167 Bacteria 9901
6 Ga0466706_267020 3300042599 Bacteria 3340
7 Ga0264413_139080 3300024493 Bacteria 7010
8 DPOL_contig14399 2035918003 Bacteria 76515
9 DPOL_contig16134 2035918003 Bacteria 12452
10 Ga0105005_1008880 3300007505 Bacteria 19421
11 Ga0466723_013226 3300042618 Bacteria 1588
12 Ga0466728_006870 3300042620 Bacteria 6682
13 Ga0466704_225517 3300042643 Bacteria 11952
14 Ga0466704_389411 3300042643 Bacteria 2113
15 Ga0466704_509800 3300042643 Bacteria 1335
16 Ga0466708_224778 3300042652 Bacteria 8866
17 Ga0123355_10678160 3300009826 Bacteria 1192
18 Ga0123356_10564788 3300010049 Bacteria 1300
19 Ga0123353_10001138 3300010167 Bacteria 32380
20 Ga0123353_10283878 3300010167 Bacteria 2540
21 Ga0123353_10343068 3300010167 Bacteria 2255
22 Ga0123353_11026922 3300010167 Bacteria 1104
23 Ga0123354_10356716 3300010882 Unclassified 1295
24 Ga0466713_088818 3300042602 Bacteria 57755
25 Ga0466716_001642 3300042605 Bacteria 6215
26 Ga0265387_1000090 3300024582 Bacteria 26311
27 Ga0466691_037135 3300042593 Bacteria 21121
28 Ga0466691_196931 3300042593 Bacteria 3907
29 JGI24702J35022_10063960 3300002462 Bacteria 1972
30 JGI24705J35276_12236969 3300002504 Bacteria 9452
31 Ga0063521_1000269 3300003973 Bacteria 33899
32 Ga0466705_435943 3300042612 Bacteria 6354
33 Ga0466705_445601 3300042612 Bacteria 7301
34 Ga0466711_284014 3300042615 Bacteria 19361
35 Ga0466715_133461 3300042616 Bacteria 84152
36 Ga0466723_112275 3300042618 Bacteria 1829
37 Ga0466726_186879 3300042619 Bacteria 19791
38 Ga0466703_276839 3300042636 Bacteria 11164
39 Ga0466709_219168 3300042648 Bacteria 5747
40 Ga0123355_10423522 3300009826 Bacteria 1699
41 Ga0123353_10081634 3300010167 Bacteria 5199
42 Ga0160466_101144 3300012809 Bacteria 8439
43 Ga0466707_019093 3300042601 Bacteria 28365
44 Ga0466722_243136 3300042609 Bacteria 2473
45 Ga0466657_012937 3300042582 Bacteria 1450
46 JGI24702J35022_10061731 3300002462 Bacteria 2006
47 JGI24705J35276_12212713 3300002504 Bacteria 1898
48 Ga0074188_1000270 3300005318 Bacteria 11461
49 Ga0466711_105587 3300042615 Bacteria 5617
50 Ga0466715_369198 3300042616 Bacteria 3016
51 Ga0466723_313427 3300042618 Bacteria 3061
52 Ga0466728_044205 3300042620 Bacteria 6721
53 Ga0466734_172774 3300042623 Bacteria 2002
54 Ga0466735_088475 3300042624 Bacteria 1307
55 Ga0466735_218912 3300042624 Bacteria 8347
56 Ga0466703_098882 3300042636 Bacteria 1533
57 Ga0466704_035267 3300042643 Bacteria 25525
58 Ga0466704_036919 3300042643 Bacteria 9740
59 Ga0466727_103610 3300042655 Bacteria 3622
60 Ga0466727_227440 3300042655 Bacteria 5978
61 Ga0123355_10446366 3300009826 Unclassified 1634
62 Ga0123354_10031700 3300010882 Bacteria 8289
63 Ga0466701_073991 3300042598 Bacteria 3946
64 Ga0466707_183098 3300042601 Bacteria 6584
65 Ga0466707_242645 3300042601 Bacteria 2280
66 Ga0160460_100583 3300012845 Bacteria 19381
67 Ga0466696_482005 3300042596 Bacteria 2867
68 Ga0068305_10032434 3300005083 Bacteria 12413
69 Ga0074188_1155342 3300005318 Unclassified 2505
70 Ga0466726_282184 3300042619 Bacteria 2137
71 Ga0466703_090843 3300042636 Bacteria 17357
72 Ga0466703_350882 3300042636 Bacteria 30976
73 Ga0466709_350948 3300042648 Bacteria 3595
74 Ga0466708_174695 3300042652 Bacteria 8211
75 Ga0466708_337754 3300042652 Bacteria 2288
76 Ga0466727_220926 3300042655 Bacteria 3248
77 Ga0466705_060583 3300042612 Bacteria 8881
78 Ga0123356_10001750 3300010049 Bacteria 23645
79 Ga0466707_040886 3300042601 Bacteria 2234
80 Ga0072941_1053289 3300005201 Bacteria 8060
81 Ga0466710_227767 3300042613 Bacteria 3635
82 Ga0466711_365712 3300042615 Bacteria 11698
83 Ga0466715_387864 3300042616 Bacteria 3864
84 Ga0466723_325522 3300042618 Bacteria 2393
85 Ga0466726_472030 3300042619 Bacteria 2127
86 Ga0466735_171057 3300042624 Bacteria 3362
87 Ga0466703_144769 3300042636 Bacteria 15489
88 Ga0466703_396491 3300042636 Bacteria 1341
89 Ga0466704_599969 3300042643 Bacteria 3136
90 Ga0466709_128248 3300042648 Bacteria 15847
91 Ga0466708_212877 3300042652 Bacteria 79784
92 Ga0466727_018589 3300042655 Bacteria 4752
93 Ga0466705_338122 3300042612 Unclassified 4488
94 Ga0466705_357061 3300042612 Bacteria 9440
95 Ga0466701_076813 3300042598 Bacteria 1187
96 Ga0072941_1055919 3300005201 Bacteria 2589
97 Ga0466705_436802 3300042612 Bacteria 4181
98 Ga0466705_445934 3300042612 Unclassified 12171
99 Ga0466711_477203 3300042615 Bacteria 5711
100 Ga0466715_115792 3300042616 Bacteria 5940
101 Ga0466715_592399 3300042616 Bacteria 7943
102 Ga0466723_075373 3300042618 Bacteria 14423
103 Ga0466723_124748 3300042618 Bacteria 48807
104 Ga0466723_229569 3300042618 Bacteria 135891
105 Ga0466729_168296 3300042621 Bacteria 14413
106 Ga0466730_051123 3300042625 Bacteria 1768
107 Ga0466724_60676 3300042649 Bacteria 15603
108 Ga0466727_256350 3300042655 Bacteria 2226
109 Ga0466705_238366 3300042612 Bacteria 4601
110 Ga0123353_10186206 3300010167 Bacteria 3283
111 Ga0160442_104640 3300012806 Bacteria 1409
112 Ga0466716_019774 3300042605 Bacteria 1249
113 Ga0104049_1029104 3300007103 Unclassified 2052
114 Ga0466705_433282 3300042612 Bacteria 9105
115 Ga0466715_018745 3300042616 Bacteria 13317
116 Ga0466715_583154 3300042616 Bacteria 7583
117 Ga0466728_052673 3300042620 Bacteria 8527
118 Ga0466704_277628 3300042643 Bacteria 15785
119 Ga0466708_318343 3300042652 Bacteria 5312
120 Ga0123355_10000256 3300009826 Bacteria 68389
121 Ga0123355_10554887 3300009826 Bacteria 1387
122 Ga0123353_10099342 3300010167 Bacteria 4691
123 Ga0123353_10108646 3300010167 Bacteria 4470
124 Ga0123353_10176735 3300010167 Bacteria 3384
125 Ga0466700_382545 3300042600 Bacteria 1549
126 Ga0466719_121509 3300042606 Bacteria 9880
127 Ga0160459_101021 3300012831 Unclassified 8055
128 Ga0466693_052064 3300042592 Bacteria 3693
129 Ga0466691_220219 3300042593 Bacteria 11339
130 Ga0466696_283887 3300042596 Bacteria 5235
131 Ga0068305_10139106 3300005083 Bacteria 2614
132 Ga0074188_1000227 3300005318 Bacteria 41018
133 Ga0466710_392314 3300042613 Bacteria 2167
134 Ga0466711_080340 3300042615 Bacteria 24032
135 Ga0466715_071976 3300042616 Bacteria 10748
136 Ga0466715_115286 3300042616 Bacteria 1295
137 Ga0466726_127382 3300042619 Bacteria 2562
138 Ga0466726_174079 3300042619 Bacteria 1465
139 Ga0466726_207182 3300042619 Bacteria 2000
140 Ga0466726_408992 3300042619 Bacteria 10187
141 Ga0466729_136603 3300042621 Bacteria 2294
142 Ga0466704_564685 3300042643 Bacteria 2216
143 Ga0466708_036939 3300042652 Bacteria 61265
144 Ga0466708_127935 3300042652 Bacteria 47397
145 Ga0466708_166272 3300042652 Bacteria 9227

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF08352 oligo_HPY Oligopeptide/dipeptide transporter, C-terminal region 286 350 0.99
PF00005 ABC_tran ABC transporter 71 235 0.85

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.