Protein Family IF05306
Metagenome
Isolate
195
Members
41
Samples
192
Scaffolds
255.56
Avg Length
Representative Sequence
- ID
- 3300042597|Ga0466699_133082|Ga0466699_133082_174_977
- Length
- 267 aa
- Sequence
- MGNAVTYSVALAGKGGTGKTTVCGLFLDHLVRSGKGPVLAVDADANSNLNEVLGVEKPVSLGEIREEIAKAEITSDKLSEGGPVSIPPGMSKQEYADFRFADALAEEENYDLLVMGRTQGKGCYCYVNNVLQEQLQKYYRHYNYLIVDNEAGLEHVSRGILPPVDLLLLVSDCSRRGIQAAGRIAAMVVELDLKVKKTGLLVNRAPNGQINEGVKEEIALQKLDLFGVIPQDDLGYEYDGAGTPLVKLPAESPVRAALEKVILTLDL
Sample Types
Isolate
1.5%
Metagenome
98.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
35.0%
Termitidae
30.0%
Unclassified
12.5%
Rhinotermitidae
10.0%
Termopsidae
7.5%
Passalidae
2.5%
Hodotermitidae
2.5%
Taxonomy
Archaea
4
Bacteria
176
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 9 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 10 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 11 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 12 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 13 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 14 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 15 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 18 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 19 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 20 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 21 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 22 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 23 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 24 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 25 | 2820906387 | Unclassified Actinobacteria Emb289P4bin41 | Isolate | Unclassified |
| 26 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 27 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 28 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 29 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 30 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 31 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 32 | 2820941830 | Unclassified Actinobacteria Cu122P5bin49 | Isolate | Unclassified |
| 33 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 34 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 35 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 36 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 37 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 38 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 39 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 40 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 41 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466691_099544 | 3300042593 | Bacteria | 13702 |
| 2 | Ga0466691_156565 | 3300042593 | Bacteria | 4425 |
| 3 | Ga0466699_005465 | 3300042597 | Bacteria | 2084 |
| 4 | Ga0466699_109425 | 3300042597 | Bacteria | 18286 |
| 5 | Ga0466707_002588 | 3300042601 | Bacteria | 4385 |
| 6 | Ga0466707_018070 | 3300042601 | Bacteria | 2192 |
| 7 | Ga0466716_016911 | 3300042605 | Bacteria | 8322 |
| 8 | Ga0466716_066085 | 3300042605 | Bacteria | 2317 |
| 9 | Ga0466719_149247 | 3300042606 | Unclassified | 2719 |
| 10 | Ga0466719_235861 | 3300042606 | Bacteria | 8202 |
| 11 | Ga0466720_132352 | 3300042607 | Bacteria | 2791 |
| 12 | Ga0466729_243284 | 3300042621 | Bacteria | 1897 |
| 13 | Ga0466703_032394 | 3300042636 | Bacteria | 5985 |
| 14 | Ga0466703_059260 | 3300042636 | Bacteria | 9763 |
| 15 | Ga0466703_107327 | 3300042636 | Bacteria | 8108 |
| 16 | Ga0466704_261942 | 3300042643 | Bacteria | 5024 |
| 17 | Ga0466704_603765 | 3300042643 | Bacteria | 11375 |
| 18 | Ga0466705_401759 | 3300042612 | Bacteria | 2016 |
| 19 | Ga0466715_373002 | 3300042616 | Bacteria | 2390 |
| 20 | Ga0466726_381940 | 3300042619 | Bacteria | 1029 |
| 21 | Ga0466729_080219 | 3300042621 | Bacteria | 1804 |
| 22 | Ga0123357_10129899 | 3300009784 | Archaea | 3141 |
| 23 | Ga0466705_103024 | 3300042612 | Bacteria | 7588 |
| 24 | Ga0466705_210639 | 3300042612 | Unclassified | 2233 |
| 25 | Ga0466690_114643 | 3300042590 | Bacteria | 1653 |
| 26 | Ga0466690_189695 | 3300042590 | Bacteria | 6932 |
| 27 | Ga0466690_216430 | 3300042590 | Bacteria | 5007 |
| 28 | Ga0466690_378067 | 3300042590 | Unclassified | 1619 |
| 29 | Ga0466716_078088 | 3300042605 | Bacteria | 4970 |
| 30 | Ga0466719_373432 | 3300042606 | Bacteria | 15697 |
| 31 | Ga0466719_427055 | 3300042606 | Bacteria | 9950 |
| 32 | Ga0466722_015693 | 3300042609 | Bacteria | 3314 |
| 33 | Ga0466722_067659 | 3300042609 | Bacteria | 24708 |
| 34 | Ga0466703_108715 | 3300042636 | Bacteria | 15529 |
| 35 | Ga0466703_249050 | 3300042636 | Bacteria | 15307 |
| 36 | Ga0466704_094016 | 3300042643 | Unclassified | 3890 |
| 37 | Ga0466704_239917 | 3300042643 | Bacteria | 52442 |
| 38 | Ga0466704_275399 | 3300042643 | Bacteria | 4006 |
| 39 | Ga0466704_302842 | 3300042643 | Unclassified | 9275 |
| 40 | Ga0466704_465430 | 3300042643 | Bacteria | 10351 |
| 41 | Ga0466708_258727 | 3300042652 | Bacteria | 2752 |
| 42 | Ga0466727_010484 | 3300042655 | Bacteria | 1356 |
| 43 | Ga0466727_304160 | 3300042655 | Bacteria | 1106 |
| 44 | Ga0466712_241651 | 3300042614 | Bacteria | 9873 |
| 45 | Ga0466718_006585 | 3300042617 | Unclassified | 1782 |
| 46 | Ga0466723_021312 | 3300042618 | Bacteria | 4516 |
| 47 | Ga0466723_054285 | 3300042618 | Bacteria | 22968 |
| 48 | Ga0466726_057628 | 3300042619 | Bacteria | 8144 |
| 49 | Ga0466726_420866 | 3300042619 | Bacteria | 1433 |
| 50 | Ga0466728_226391 | 3300042620 | Bacteria | 2368 |
| 51 | Ga0123356_10159923 | 3300010049 | Bacteria | 2248 |
| 52 | Ga0123354_10185553 | 3300010882 | Bacteria | 2354 |
| 53 | Ga0466705_118016 | 3300042612 | Bacteria | 3949 |
| 54 | Ga0466705_201094 | 3300042612 | Bacteria | 22926 |
| 55 | Ga0456237_0000561 | 3300041968 | Bacteria | 5644 |
| 56 | Ga0466690_202691 | 3300042590 | Bacteria | 4532 |
| 57 | Ga0466696_267124 | 3300042596 | Bacteria | 1673 |
| 58 | Ga0466699_227358 | 3300042597 | Bacteria | 2135 |
| 59 | Ga0466707_297502 | 3300042601 | Bacteria | 1131 |
| 60 | Ga0466719_396027 | 3300042606 | Bacteria | 3091 |
| 61 | Ga0466720_108612 | 3300042607 | Bacteria | 122313 |
| 62 | Ga0466722_073642 | 3300042609 | Bacteria | 8528 |
| 63 | Ga0466735_021958 | 3300042624 | Bacteria | 21027 |
| 64 | Ga0466735_185478 | 3300042624 | Bacteria | 3314 |
| 65 | Ga0466703_136453 | 3300042636 | Bacteria | 5231 |
| 66 | Ga0466704_011596 | 3300042643 | Bacteria | 5512 |
| 67 | Ga0466704_061373 | 3300042643 | Bacteria | 28067 |
| 68 | Ga0466704_417717 | 3300042643 | Bacteria | 1309 |
| 69 | Ga0466709_064273 | 3300042648 | Bacteria | 18619 |
| 70 | Ga0466708_114698 | 3300042652 | Bacteria | 15315 |
| 71 | Ga0466708_125344 | 3300042652 | Bacteria | 26258 |
| 72 | Ga0466727_007745 | 3300042655 | Bacteria | 3394 |
| 73 | Ga0466727_247758 | 3300042655 | Bacteria | 1302 |
| 74 | Ga0466711_357463 | 3300042615 | Bacteria | 11036 |
| 75 | Ga0466715_542749 | 3300042616 | Bacteria | 20607 |
| 76 | Ga0466723_014950 | 3300042618 | Bacteria | 3624 |
| 77 | Ga0466723_074624 | 3300042618 | Archaea | 15883 |
| 78 | Ga0466726_309279 | 3300042619 | Bacteria | 1283 |
| 79 | Ga0466728_376532 | 3300042620 | Bacteria | 8914 |
| 80 | Ga0466728_433053 | 3300042620 | Bacteria | 10296 |
| 81 | Ga0123356_10150010 | 3300010049 | Bacteria | 2313 |
| 82 | Ga0466690_128486 | 3300042590 | Unclassified | 2433 |
| 83 | Ga0466699_251142 | 3300042597 | Bacteria | 6399 |
| 84 | Ga0466707_087479 | 3300042601 | Bacteria | 1429 |
| 85 | Ga0466716_137059 | 3300042605 | Bacteria | 3813 |
| 86 | Ga0466722_032927 | 3300042609 | Bacteria | 3586 |
| 87 | Ga0466727_130255 | 3300042655 | Bacteria | 3097 |
| 88 | Ga0466727_167340 | 3300042655 | Bacteria | 1051 |
| 89 | Ga0466727_204674 | 3300042655 | Bacteria | 1659 |
| 90 | Ga0466715_006191 | 3300042616 | Bacteria | 6592 |
| 91 | Ga0466723_130490 | 3300042618 | Bacteria | 37311 |
| 92 | Ga0466723_331330 | 3300042618 | Bacteria | 1904 |
| 93 | Ga0466729_158480 | 3300042621 | Bacteria | 1117 |
| 94 | Ga0466729_161636 | 3300042621 | Bacteria | 1932 |
| 95 | Ga0123355_10098405 | 3300009826 | Bacteria | 4614 |
| 96 | Ga0466732_267306 | 3300042656 | Bacteria | 1009 |
| 97 | Ga0466690_176047 | 3300042590 | Unclassified | 2475 |
| 98 | Ga0466694_270917 | 3300042594 | Bacteria | 1327 |
| 99 | Ga0466696_044957 | 3300042596 | Bacteria | 15173 |
| 100 | Ga0466696_111677 | 3300042596 | Bacteria | 28348 |
| 101 | Ga0466707_047041 | 3300042601 | Bacteria | 2823 |
| 102 | Ga0466713_032679 | 3300042602 | Bacteria | 1405 |
| 103 | Ga0466716_411349 | 3300042605 | Bacteria | 7144 |
| 104 | Ga0466719_041256 | 3300042606 | Bacteria | 4915 |
| 105 | Ga0466719_238310 | 3300042606 | Bacteria | 1992 |
| 106 | Ga0466722_202305 | 3300042609 | Bacteria | 11682 |
| 107 | IMNBL1DRAFT_c0000980 | 3300000062 | Bacteria | 22025 |
| 108 | Ga0466703_111795 | 3300042636 | Bacteria | 16296 |
| 109 | Ga0466704_188711 | 3300042643 | Bacteria | 1468 |
| 110 | Ga0466704_256979 | 3300042643 | Bacteria | 1551 |
| 111 | Ga0466704_451723 | 3300042643 | Bacteria | 3481 |
| 112 | Ga0466708_070435 | 3300042652 | Bacteria | 2882 |
| 113 | Ga0466708_129371 | 3300042652 | Bacteria | 18176 |
| 114 | Ga0466708_184924 | 3300042652 | Unclassified | 9314 |
| 115 | Ga0466727_150912 | 3300042655 | Bacteria | 1359 |
| 116 | Ga0466712_095605 | 3300042614 | Bacteria | 6433 |
| 117 | Ga0466712_119123 | 3300042614 | Bacteria | 2485 |
| 118 | Ga0466715_317512 | 3300042616 | Bacteria | 7501 |
| 119 | Ga0466726_261249 | 3300042619 | Bacteria | 1192 |
| 120 | Ga0466726_361634 | 3300042619 | Bacteria | 1714 |
| 121 | Ga0466726_426310 | 3300042619 | Bacteria | 1044 |
| 122 | Ga0466728_187901 | 3300042620 | Bacteria | 16781 |
| 123 | Ga0466729_175542 | 3300042621 | Bacteria | 5089 |
| 124 | Ga0466690_351116 | 3300042590 | Unclassified | 1888 |
| 125 | Ga0466690_427857 | 3300042590 | Bacteria | 3344 |
| 126 | Ga0466691_023160 | 3300042593 | Bacteria | 3892 |
| 127 | Ga0466696_013382 | 3300042596 | Bacteria | 35562 |
| 128 | Ga0466696_478413 | 3300042596 | Bacteria | 1912 |
| 129 | Ga0466699_070361 | 3300042597 | Bacteria | 22948 |
| 130 | Ga0466699_184634 | 3300042597 | Bacteria | 1127 |
| 131 | Ga0466700_479082 | 3300042600 | Bacteria | 2170 |
| 132 | Ga0466716_274446 | 3300042605 | Bacteria | 5249 |
| 133 | Ga0466719_193493 | 3300042606 | Unclassified | 1678 |
| 134 | Ga0466720_021091 | 3300042607 | Bacteria | 12788 |
| 135 | Ga0466722_219003 | 3300042609 | Bacteria | 5961 |
| 136 | Ga0466735_080399 | 3300042624 | Unclassified | 2767 |
| 137 | Ga0466703_075486 | 3300042636 | Bacteria | 14808 |
| 138 | Ga0466727_073690 | 3300042655 | Unclassified | 3298 |
| 139 | Ga0466727_243038 | 3300042655 | Bacteria | 3489 |
| 140 | Ga0466705_396287 | 3300042612 | Bacteria | 2901 |
| 141 | Ga0466705_486289 | 3300042612 | Bacteria | 2516 |
| 142 | Ga0466711_143067 | 3300042615 | Bacteria | 38768 |
| 143 | Ga0466711_224240 | 3300042615 | Bacteria | 1630 |
| 144 | Ga0466715_587947 | 3300042616 | Bacteria | 13104 |
| 145 | Ga0466723_219649 | 3300042618 | Bacteria | 7650 |
| 146 | Ga0466726_329053 | 3300042619 | Bacteria | 6626 |
| 147 | Ga0466705_023505 | 3300042612 | Bacteria | 24705 |
| 148 | Ga0264413_102355 | 3300024493 | Bacteria | 7998 |
| 149 | Ga0466690_036757 | 3300042590 | Bacteria | 2101 |
| 150 | Ga0466690_118836 | 3300042590 | Bacteria | 1683 |
| 151 | Ga0466692_062574 | 3300042591 | Bacteria | 1981 |
| 152 | Ga0466692_149145 | 3300042591 | Bacteria | 1874 |
| 153 | Ga0466691_066069 | 3300042593 | Bacteria | 10035 |
| 154 | Ga0466696_497346 | 3300042596 | Bacteria | 2299 |
| 155 | Ga0466699_133082 | 3300042597 | Bacteria | 1382 |
| 156 | Ga0466699_165240 | 3300042597 | Bacteria | 2221 |
| 157 | Ga0466699_331960 | 3300042597 | Bacteria | 5911 |
| 158 | Ga0466706_094895 | 3300042599 | Bacteria | 9055 |
| 159 | Ga0466700_355103 | 3300042600 | Bacteria | 3799 |
| 160 | Ga0466719_130923 | 3300042606 | Bacteria | 1554 |
| 161 | Ga0466720_046475 | 3300042607 | Bacteria | 14856 |
| 162 | Ga0466722_261703 | 3300042609 | Bacteria | 4926 |
| 163 | Ga0466698_314305 | 3300042610 | Bacteria | 2669 |
| 164 | Ga0466703_073008 | 3300042636 | Bacteria | 2255 |
| 165 | Ga0466703_406661 | 3300042636 | Bacteria | 5679 |
| 166 | Ga0466703_419539 | 3300042636 | Bacteria | 6998 |
| 167 | Ga0466704_171201 | 3300042643 | Bacteria | 2511 |
| 168 | Ga0466704_325459 | 3300042643 | Bacteria | 3098 |
| 169 | Ga0466709_030747 | 3300042648 | Bacteria | 1128 |
| 170 | Ga0466708_035099 | 3300042652 | Archaea | 5130 |
| 171 | Ga0466723_306087 | 3300042618 | Bacteria | 1858 |
| 172 | Ga0466726_302597 | 3300042619 | Archaea | 3160 |
| 173 | Ga0466726_316012 | 3300042619 | Bacteria | 3768 |
| 174 | Ga0123355_10238828 | 3300009826 | Bacteria | 2579 |
| 175 | Ga0466690_107058 | 3300042590 | Bacteria | 9290 |
| 176 | Ga0466690_303812 | 3300042590 | Bacteria | 2101 |
| 177 | Ga0466692_151443 | 3300042591 | Bacteria | 3014 |
| 178 | Ga0466692_170570 | 3300042591 | Bacteria | 11168 |
| 179 | Ga0466696_059868 | 3300042596 | Bacteria | 9165 |
| 180 | Ga0466696_074315 | 3300042596 | Bacteria | 2953 |
| 181 | Ga0466719_129417 | 3300042606 | Bacteria | 6542 |
| 182 | Ga0466719_456740 | 3300042606 | Bacteria | 2916 |
| 183 | Ga0466722_037125 | 3300042609 | Bacteria | 6221 |
| 184 | Ga0466722_200874 | 3300042609 | Bacteria | 1434 |
| 185 | Ga0466703_174715 | 3300042636 | Bacteria | 6610 |
| 186 | Ga0466703_233233 | 3300042636 | Bacteria | 13106 |
| 187 | Ga0466704_469288 | 3300042643 | Bacteria | 9557 |
| 188 | Ga0466727_229380 | 3300042655 | Bacteria | 1714 |
| 189 | Ga0466705_478967 | 3300042612 | Unclassified | 4909 |
| 190 | Ga0466711_402910 | 3300042615 | Bacteria | 2268 |
| 191 | Ga0466715_468390 | 3300042616 | Bacteria | 1724 |
| 192 | Ga0466723_086556 | 3300042618 | Unclassified | 3918 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.