Protein Family IF05265
Metagenome
Metatranscriptome
Isolate
157
Members
47
Samples
152
Scaffolds
139.71
Avg Length
Representative Sequence
- ID
- 3300042597|Ga0466699_009307|Ga0466699_009307_17229_17711
- Length
- 160 aa
- Sequence
- VLNSILIDAGPLIALFDSSDRHHKGIKSFLKENPYRYISTVAVFTEVSHMLDFSVHAQRDFYEWIMCKGVFISDINQNDMPRIVRLTEQYADLPMDFADATLVVTAEKTGIQEIISLDRDFDVYRLPGKERIHNVYRLSSISSPLNLRDSKSPPYHHRAG
Sample Types
Isolate
3.2%
Metagenome
96.2%
MAG
0.0%
Metatranscriptome
0.6%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
61.4%
Kalotermitidae
15.9%
Unclassified
11.4%
Rhinotermitidae
6.8%
Hodotermitidae
2.3%
Termopsidae
2.3%
Taxonomy
Archaea
1
Bacteria
112
Eukaryota
0
Viruses
0
Unclassified
44
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 2 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 3 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 4 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 5 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 6 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 7 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 8 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 9 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 10 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 11 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 14 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 15 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 16 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 17 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 18 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 19 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 20 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 21 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 22 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 23 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 24 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 25 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 26 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 27 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 28 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 29 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 30 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 31 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 32 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 33 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 34 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 35 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 36 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 37 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 38 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 39 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 40 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 41 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 42 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 43 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 44 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 45 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 46 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 47 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_074942 | 3300042612 | Bacteria | 7803 |
| 2 | Ga0466733_145737 | 3300042659 | Bacteria | 1945 |
| 3 | Ga0466731_346130 | 3300042622 | Unclassified | 1356 |
| 4 | Ga0466712_142301 | 3300042614 | Bacteria | 17272 |
| 5 | Ga0466712_156915 | 3300042614 | Bacteria | 21573 |
| 6 | Ga0466718_005689 | 3300042617 | Unclassified | 2834 |
| 7 | Ga0466718_042183 | 3300042617 | Bacteria | 62729 |
| 8 | Ga0466718_154028 | 3300042617 | Unclassified | 1021 |
| 9 | Ga0123353_10077395 | 3300010167 | Bacteria | 5345 |
| 10 | Ga0466720_022852 | 3300042607 | Bacteria | 5742 |
| 11 | Ga0466720_166038 | 3300042607 | Bacteria | 2799 |
| 12 | Ga0466698_468993 | 3300042610 | Bacteria | 1772 |
| 13 | Ga0466692_150410 | 3300042591 | Bacteria | 17592 |
| 14 | Ga0466699_006552 | 3300042597 | Bacteria | 1377 |
| 15 | Ga0466701_015337 | 3300042598 | Bacteria | 1458 |
| 16 | AustNasuHG_c1013888 | 3300000089 | Unclassified | 2751 |
| 17 | JGI24698J34947_10003554 | 3300002449 | Bacteria | 8464 |
| 18 | JGI24698J34947_10046807 | 3300002449 | Unclassified | 2199 |
| 19 | JGI24695J34938_10031659 | 3300002450 | Archaea | 2451 |
| 20 | Ga0072941_1018465 | 3300005201 | Bacteria | 27703 |
| 21 | Ga0072941_1046601 | 3300005201 | Bacteria | 2785 |
| 22 | Ga0072941_1055187 | 3300005201 | Unclassified | 4223 |
| 23 | Ga0072941_1076774 | 3300005201 | Bacteria | 1722 |
| 24 | Ga0466712_091910 | 3300042614 | Bacteria | 39871 |
| 25 | Ga0466712_093007 | 3300042614 | Bacteria | 17888 |
| 26 | Ga0466728_234327 | 3300042620 | Bacteria | 5449 |
| 27 | Ga0466729_113772 | 3300042621 | Bacteria | 2250 |
| 28 | Ga0123356_10003055 | 3300010049 | Bacteria | 17683 |
| 29 | Ga0466706_185910 | 3300042599 | Unclassified | 1178 |
| 30 | Ga0466720_118153 | 3300042607 | Unclassified | 1041 |
| 31 | Ga0264413_117241 | 3300024493 | Unclassified | 2351 |
| 32 | Ga0415639_017387 | 3300038395 | Unclassified | 1487 |
| 33 | Ga0466692_065484 | 3300042591 | Bacteria | 3819 |
| 34 | Ga0466695_098810 | 3300042595 | Unclassified | 1030 |
| 35 | AustNasuHG_c1028069 | 3300000089 | Bacteria | 1693 |
| 36 | JGI24698J34947_10000008 | 3300002449 | Bacteria | 53028 |
| 37 | JGI24698J34947_10000821 | 3300002449 | Bacteria | 15504 |
| 38 | JGI24698J34947_10011930 | 3300002449 | Bacteria | 4771 |
| 39 | JGI24698J34947_10056321 | 3300002449 | Bacteria | 1955 |
| 40 | Ga0072941_1007821 | 3300005201 | Unclassified | 1474 |
| 41 | Ga0072941_1055186 | 3300005201 | Bacteria | 5173 |
| 42 | Ga0466712_105705 | 3300042614 | Unclassified | 4166 |
| 43 | Ga0466712_159242 | 3300042614 | Bacteria | 52985 |
| 44 | Ga0466712_294839 | 3300042614 | Unclassified | 5224 |
| 45 | Ga0466718_066653 | 3300042617 | Unclassified | 1177 |
| 46 | Ga0466728_246773 | 3300042620 | Bacteria | 8300 |
| 47 | Ga0123357_10304103 | 3300009784 | Bacteria | 1605 |
| 48 | Ga0123355_10009203 | 3300009826 | Bacteria | 14990 |
| 49 | Ga0123356_10341596 | 3300010049 | Unclassified | 1618 |
| 50 | Ga0123356_10672172 | 3300010049 | Unclassified | 1203 |
| 51 | Ga0123356_12032082 | 3300010049 | Unclassified | 717 |
| 52 | Ga0466720_076706 | 3300042607 | Unclassified | 3562 |
| 53 | Ga0466720_123923 | 3300042607 | Bacteria | 34590 |
| 54 | Ga0466698_021667 | 3300042610 | Unclassified | 2123 |
| 55 | Ga0466698_166277 | 3300042610 | Bacteria | 1704 |
| 56 | Ga0264413_131073 | 3300024493 | Unclassified | 1819 |
| 57 | Ga0466694_009362 | 3300042594 | Bacteria | 28493 |
| 58 | Ga0466695_348049 | 3300042595 | Bacteria | 1740 |
| 59 | Ga0466699_009307 | 3300042597 | Bacteria | 35411 |
| 60 | FAAS_10635250 | 3300001880 | Unclassified | 502 |
| 61 | JGI24698J34947_10001653 | 3300002449 | Bacteria | 11877 |
| 62 | JGI24698J34947_10022278 | 3300002449 | Bacteria | 3400 |
| 63 | Ga0072941_1007823 | 3300005201 | Bacteria | 2094 |
| 64 | Ga0074263_102274 | 3300005485 | Bacteria | 6941 |
| 65 | Ga0466733_188004 | 3300042659 | Bacteria | 1231 |
| 66 | Ga0466729_200066 | 3300042621 | Bacteria | 1056 |
| 67 | Ga0466704_385213 | 3300042643 | Unclassified | 2448 |
| 68 | Ga0466712_038723 | 3300042614 | Unclassified | 3230 |
| 69 | Ga0466712_067970 | 3300042614 | Bacteria | 16434 |
| 70 | Ga0466712_149716 | 3300042614 | Bacteria | 20358 |
| 71 | Ga0466718_028236 | 3300042617 | Bacteria | 32464 |
| 72 | Ga0466718_048888 | 3300042617 | Unclassified | 13659 |
| 73 | Ga0466718_064365 | 3300042617 | Bacteria | 11160 |
| 74 | Ga0123353_10065931 | 3300010167 | Bacteria | 5812 |
| 75 | Ga0466720_015742 | 3300042607 | Bacteria | 17121 |
| 76 | Ga0466722_147416 | 3300042609 | Bacteria | 6550 |
| 77 | Ga0415639_071014 | 3300038395 | Unclassified | 3970 |
| 78 | Ga0466694_129696 | 3300042594 | Bacteria | 2149 |
| 79 | AustNasuHG_c1001065 | 3300000089 | Bacteria | 9863 |
| 80 | AustNasuHG_c1020888 | 3300000089 | Bacteria | 2126 |
| 81 | FAAS_10587808 | 3300001880 | Unclassified | 549 |
| 82 | JGI24698J34947_10022642 | 3300002449 | Bacteria | 3366 |
| 83 | JGI24698J34947_10080745 | 3300002449 | Unclassified | 1527 |
| 84 | JGI24695J34938_10049310 | 3300002450 | Bacteria | 1851 |
| 85 | JGI24705J35276_12051465 | 3300002504 | Bacteria | 919 |
| 86 | Ga0072941_1030565 | 3300005201 | Bacteria | 2768 |
| 87 | Ga0466704_217340 | 3300042643 | Bacteria | 8151 |
| 88 | Ga0466718_151432 | 3300042617 | Bacteria | 3942 |
| 89 | Ga0466728_299807 | 3300042620 | Bacteria | 9411 |
| 90 | Ga0123356_12947471 | 3300010049 | Unclassified | 595 |
| 91 | Ga0466716_115784 | 3300042605 | Bacteria | 19907 |
| 92 | Ga0255786_1031466 | 3300022815 | Unclassified | 704 |
| 93 | Ga0466690_057741 | 3300042590 | Bacteria | 6519 |
| 94 | Ga0466692_107421 | 3300042591 | Bacteria | 7431 |
| 95 | Ga0466694_034044 | 3300042594 | Unclassified | 1827 |
| 96 | Ga0466699_005735 | 3300042597 | Bacteria | 1373 |
| 97 | Ga0466699_086680 | 3300042597 | Bacteria | 5147 |
| 98 | JGI24698J34947_10012695 | 3300002449 | Bacteria | 4613 |
| 99 | JGI24698J34947_10136857 | 3300002449 | Unclassified | 1038 |
| 100 | JGI24695J34938_10008810 | 3300002450 | Bacteria | 5711 |
| 101 | JGI24699J35502_11120384 | 3300002509 | Bacteria | 3247 |
| 102 | JGI24696J40584_12899163 | 3300002834 | Bacteria | 1175 |
| 103 | Ga0074263_114065 | 3300005485 | Bacteria | 1355 |
| 104 | Ga0466702_194664 | 3300042635 | Unclassified | 1611 |
| 105 | Ga0466718_007170 | 3300042617 | Bacteria | 1008 |
| 106 | Ga0466726_177271 | 3300042619 | Bacteria | 4122 |
| 107 | Ga0466722_256014 | 3300042609 | Bacteria | 6374 |
| 108 | Ga0466692_136612 | 3300042591 | Bacteria | 7984 |
| 109 | Ga0466691_119997 | 3300042593 | Bacteria | 11740 |
| 110 | Ga0466694_404110 | 3300042594 | Bacteria | 6339 |
| 111 | Ga0466699_433170 | 3300042597 | Bacteria | 1931 |
| 112 | AustNasuHG_c1002764 | 3300000089 | Bacteria | 6329 |
| 113 | AustNasuHG_c1011115 | 3300000089 | Bacteria | 3123 |
| 114 | JGI24698J34947_10014268 | 3300002449 | Bacteria | 4327 |
| 115 | JGI24698J34947_10017878 | 3300002449 | Bacteria | 3839 |
| 116 | JGI24698J34947_10029421 | 3300002449 | Unclassified | 2901 |
| 117 | JGI24695J34938_10130344 | 3300002450 | Unclassified | 1025 |
| 118 | JGI24702J35022_10011218 | 3300002462 | Bacteria | 4994 |
| 119 | Ga0072940_1056524 | 3300005200 | Unclassified | 2211 |
| 120 | Ga0072941_1006645 | 3300005201 | Bacteria | 22563 |
| 121 | Ga0072941_1007822 | 3300005201 | Unclassified | 3599 |
| 122 | Ga0072941_1013847 | 3300005201 | Unclassified | 652 |
| 123 | Ga0466731_018351 | 3300042622 | Bacteria | 2101 |
| 124 | Ga0123355_10006065 | 3300009826 | Bacteria | 17813 |
| 125 | Ga0123356_10396662 | 3300010049 | Bacteria | 1516 |
| 126 | Ga0123353_10040284 | 3300010167 | Bacteria | 7369 |
| 127 | Ga0466694_246529 | 3300042594 | Bacteria | 4228 |
| 128 | Ga0466699_023620 | 3300042597 | Bacteria | 5908 |
| 129 | Ga0466699_235884 | 3300042597 | Bacteria | 2242 |
| 130 | FAAS_10003252 | 3300001880 | Unclassified | 1297 |
| 131 | JGI24698J34947_10012663 | 3300002449 | Bacteria | 4619 |
| 132 | JGI24698J34947_10014065 | 3300002449 | Bacteria | 4360 |
| 133 | JGI24698J34947_10020297 | 3300002449 | Bacteria | 3580 |
| 134 | Ga0072941_1005276 | 3300005201 | Bacteria | 11022 |
| 135 | Ga0072941_1012930 | 3300005201 | Bacteria | 9401 |
| 136 | Ga0072941_1012931 | 3300005201 | Bacteria | 7611 |
| 137 | Ga0072941_1080852 | 3300005201 | Unclassified | 3686 |
| 138 | Ga0466703_073711 | 3300042636 | Bacteria | 9670 |
| 139 | Ga0466718_094439 | 3300042617 | Bacteria | 10276 |
| 140 | Ga0123353_12695632 | 3300010167 | Unclassified | 585 |
| 141 | Ga0466700_046389 | 3300042600 | Bacteria | 15689 |
| 142 | Ga0466716_040936 | 3300042605 | Bacteria | 3237 |
| 143 | Ga0466720_105696 | 3300042607 | Unclassified | 2363 |
| 144 | Ga0466720_133387 | 3300042607 | Bacteria | 11769 |
| 145 | Ga0466692_117010 | 3300042591 | Bacteria | 1234 |
| 146 | Ga0466694_288050 | 3300042594 | Bacteria | 21720 |
| 147 | Ga0466699_316478 | 3300042597 | Bacteria | 2243 |
| 148 | AustNasuHG_c1024788 | 3300000089 | Unclassified | 1894 |
| 149 | JGI24695J34938_10049924 | 3300002450 | Bacteria | 1837 |
| 150 | JGI24705J35276_12209653 | 3300002504 | Bacteria | 1803 |
| 151 | JGI24699J35502_11129138 | 3300002509 | Bacteria | 4611 |
| 152 | Ga0072941_1050434 | 3300005201 | Unclassified | 1186 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01850 | PIN | PIN domain | 5 | 123 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.