Protein Family IF05222
Metagenome
Isolate
190
Members
71
Samples
172
Scaffolds
352.47
Avg Length
Representative Sequence
- ID
- 3300042596|Ga0466696_331148|Ga0466696_331148_4208_5407
- Length
- 399 aa
- Sequence
- LSFADRRPEESSDLPFTDYLRKDASPLVFSTLKGRRKQPEQSGKKMISAPSVSPQELLDVLLHVAPVRPVFIWGQPGIGKSALVEQFAFSVGLECVSLLGSQLAPEDIIGVPRIVDGCSVFCPPRNIARQEAYCLFLDELNSCSMEVQKAFYSLIHEQRLGEYKLPKGSIVVGAGNRAQDSAIVKPMSSALINRMAHFQLKVSSRQWLEWAGLNGIHPLIMEYVGLRPDHLWSKPPKLEEPFSTPRSWHILSDAMKEYGQEPRTEDVLRLAKACLSPNHAIQFNSFIKQVRNRYQLSAILSGKAQWPEDPENRDVLFFLAQSLRAQLVKELPQEKKQSSSESLELANNAKRLIKDLSRISLEMAQMTVAVGDDSEGKSNELPDWFLVELIRDLPKLAKK
Sample Types
Isolate
9.5%
Metagenome
90.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
40.0%
Unclassified
20.0%
Kalotermitidae
20.0%
Termopsidae
5.7%
Blattidae
4.3%
Rhinotermitidae
4.3%
Passalidae
1.4%
Hodotermitidae
1.4%
Drosophilidae
1.4%
Elmidae
1.4%
Taxonomy
Archaea
0
Bacteria
172
Eukaryota
0
Viruses
0
Unclassified
18
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820882373 | Unclassified Actinobacteria Lab288P1bin45 | Isolate | Unclassified |
| 2 | 2524614537 | Lysinibacillus sphaericus OT4b.31 | Isolate | Unclassified |
| 3 | 2751185832 | Lysinibacillus sp. AR18-8 | Isolate | Unclassified |
| 4 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 5 | 2820460928 | Unclassified Firmicutes Lab288P3bin140 | Isolate | Unclassified |
| 6 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 7 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 8 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 9 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 10 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 11 | 2940419646 | Paenibacillus sp. PastF-4 | Isolate | Blattidae |
| 12 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 13 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 14 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 15 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 16 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 17 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 18 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 19 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 20 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 21 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 22 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 23 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 24 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 25 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 26 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 27 | 2515154104 | Streptomyces sp. KhCrAH-244 | Isolate | Unclassified |
| 28 | 2820072841 | Unclassified Proteobacteria Nt197P3bin127 | Isolate | Unclassified |
| 29 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 30 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 31 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 32 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 33 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 34 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 35 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 36 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 37 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 38 | 2820472365 | Unclassified Firmicutes Lab288P1bin87 | Isolate | Unclassified |
| 39 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 40 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 41 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 42 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 43 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 44 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 45 | 2940425923 | Paenibacillus sp. PastH-4 | Isolate | Blattidae |
| 46 | 2820946191 | Unclassified Acidobacteria Nt197P3bin31 | Isolate | Unclassified |
| 47 | 2820654856 | Unclassified Firmicutes Cu122P1bin2 | Isolate | Unclassified |
| 48 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 49 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 50 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 51 | 2820414148 | Unclassified Firmicutes Lab288P3bin93 | Isolate | Unclassified |
| 52 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 53 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 54 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 55 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 56 | 2940413413 | Paenibacillus sp. PastH-3 | Isolate | Blattidae |
| 57 | 3006461590 | Streptomyces sp. RB5 | Isolate | Termitidae |
| 58 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 59 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 60 | 2820353569 | Unclassified Firmicutes Nt197P3bin28 | Isolate | Unclassified |
| 61 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 62 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 63 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 64 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 65 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 66 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 67 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 68 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 69 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 70 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 71 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466731_359166 | 3300042622 | Bacteria | 8976 |
| 2 | Ga0466735_133979 | 3300042624 | Bacteria | 1909 |
| 3 | Ga0466703_069675 | 3300042636 | Bacteria | 2065 |
| 4 | Ga0466708_017158 | 3300042652 | Bacteria | 3428 |
| 5 | Ga0466708_174465 | 3300042652 | Bacteria | 7754 |
| 6 | Ga0466727_142508 | 3300042655 | Bacteria | 1652 |
| 7 | Ga0466705_403300 | 3300042612 | Bacteria | 77554 |
| 8 | Ga0466711_025022 | 3300042615 | Bacteria | 3593 |
| 9 | Ga0466715_293926 | 3300042616 | Bacteria | 1418 |
| 10 | Ga0466715_366645 | 3300042616 | Unclassified | 6313 |
| 11 | Ga0466723_235150 | 3300042618 | Bacteria | 3680 |
| 12 | Ga0466726_319512 | 3300042619 | Bacteria | 3905 |
| 13 | Ga0466728_137164 | 3300042620 | Bacteria | 2132 |
| 14 | Ga0456237_0012827 | 3300041968 | Bacteria | 1208 |
| 15 | Ga0466693_062193 | 3300042592 | Bacteria | 1945 |
| 16 | Ga0466691_095587 | 3300042593 | Bacteria | 5189 |
| 17 | Ga0466691_113193 | 3300042593 | Bacteria | 11567 |
| 18 | Ga0123356_10008798 | 3300010049 | Bacteria | 10000 |
| 19 | Ga0466706_086267 | 3300042599 | Bacteria | 1646 |
| 20 | Ga0466719_122836 | 3300042606 | Unclassified | 3005 |
| 21 | Ga0466720_088974 | 3300042607 | Unclassified | 4693 |
| 22 | Ga0466722_189919 | 3300042609 | Bacteria | 2737 |
| 23 | Ga0072941_1027316 | 3300005201 | Bacteria | 22959 |
| 24 | Ga0466705_194597 | 3300042612 | Bacteria | 5599 |
| 25 | Ga0466705_362738 | 3300042612 | Unclassified | 2641 |
| 26 | Ga0466704_200199 | 3300042643 | Bacteria | 15600 |
| 27 | Ga0466704_357594 | 3300042643 | Bacteria | 14458 |
| 28 | Ga0466708_130944 | 3300042652 | Unclassified | 4218 |
| 29 | Ga0466727_114125 | 3300042655 | Bacteria | 1313 |
| 30 | Ga0466727_248085 | 3300042655 | Bacteria | 4642 |
| 31 | Ga0466715_039786 | 3300042616 | Bacteria | 1842 |
| 32 | Ga0466715_316682 | 3300042616 | Bacteria | 4633 |
| 33 | Ga0466726_191369 | 3300042619 | Bacteria | 2396 |
| 34 | Ga0415639_042070 | 3300038395 | Bacteria | 6140 |
| 35 | Ga0466691_007976 | 3300042593 | Bacteria | 4839 |
| 36 | Ga0466696_331148 | 3300042596 | Bacteria | 25482 |
| 37 | Ga0123357_10003975 | 3300009784 | Bacteria | 17181 |
| 38 | Ga0466707_211247 | 3300042601 | Bacteria | 4553 |
| 39 | Ga0466717_253381 | 3300042604 | Bacteria | 21432 |
| 40 | Ga0466719_234645 | 3300042606 | Unclassified | 3606 |
| 41 | Ga0466698_437250 | 3300042610 | Bacteria | 3368 |
| 42 | Ga0068302_10527177 | 3300005071 | Bacteria | 1211 |
| 43 | Ga0466734_118895 | 3300042623 | Bacteria | 1433 |
| 44 | Ga0466735_166047 | 3300042624 | Unclassified | 1371 |
| 45 | Ga0466702_138160 | 3300042635 | Bacteria | 1199 |
| 46 | Ga0466703_121173 | 3300042636 | Bacteria | 1580 |
| 47 | Ga0466703_222301 | 3300042636 | Bacteria | 2925 |
| 48 | Ga0466704_323124 | 3300042643 | Bacteria | 40862 |
| 49 | Ga0466724_30115 | 3300042649 | Bacteria | 246830 |
| 50 | Ga0466712_038713 | 3300042614 | Bacteria | 5946 |
| 51 | Ga0466711_082771 | 3300042615 | Unclassified | 9145 |
| 52 | Ga0466715_260323 | 3300042616 | Bacteria | 6618 |
| 53 | Ga0466715_458872 | 3300042616 | Bacteria | 11403 |
| 54 | Ga0466726_034962 | 3300042619 | Bacteria | 6130 |
| 55 | Ga0466691_047306 | 3300042593 | Unclassified | 9898 |
| 56 | Ga0466694_049567 | 3300042594 | Bacteria | 12282 |
| 57 | Ga0123355_10307933 | 3300009826 | Unclassified | 2151 |
| 58 | Ga0123356_10096202 | 3300010049 | Bacteria | 2831 |
| 59 | Ga0123356_10519052 | 3300010049 | Bacteria | 1349 |
| 60 | Ga0123353_10011377 | 3300010167 | Bacteria | 12531 |
| 61 | Ga0123353_10362240 | 3300010167 | Bacteria | 2178 |
| 62 | Ga0123353_10369688 | 3300010167 | Bacteria | 2150 |
| 63 | Ga0123354_10210186 | 3300010882 | Bacteria | 2106 |
| 64 | Ga0466707_066700 | 3300042601 | Bacteria | 54784 |
| 65 | Ga0466707_091139 | 3300042601 | Bacteria | 1801 |
| 66 | Ga0466713_049610 | 3300042602 | Bacteria | 2417 |
| 67 | Ga0466716_443433 | 3300042605 | Bacteria | 1766 |
| 68 | JGI24698J34947_10004817 | 3300002449 | Bacteria | 7383 |
| 69 | Ga0466705_033730 | 3300042612 | Bacteria | 25724 |
| 70 | Ga0466703_131463 | 3300042636 | Bacteria | 4333 |
| 71 | Ga0466704_256563 | 3300042643 | Bacteria | 11107 |
| 72 | Ga0466704_267305 | 3300042643 | Bacteria | 6005 |
| 73 | Ga0466704_428312 | 3300042643 | Bacteria | 1292 |
| 74 | Ga0466704_617255 | 3300042643 | Bacteria | 7475 |
| 75 | Ga0466708_059893 | 3300042652 | Bacteria | 3158 |
| 76 | Ga0466725_212437 | 3300042654 | Bacteria | 1122 |
| 77 | Ga0466711_211148 | 3300042615 | Bacteria | 1594 |
| 78 | Ga0466715_028767 | 3300042616 | Bacteria | 15104 |
| 79 | Ga0415639_006723 | 3300038395 | Bacteria | 3054 |
| 80 | Ga0466692_012689 | 3300042591 | Bacteria | 4392 |
| 81 | Ga0123353_10172894 | 3300010167 | Bacteria | 3427 |
| 82 | Ga0123354_10016372 | 3300010882 | Bacteria | 11618 |
| 83 | Ga0123354_10235903 | 3300010882 | Bacteria | 1898 |
| 84 | Ga0466700_419218 | 3300042600 | Bacteria | 1506 |
| 85 | Ga0466707_112577 | 3300042601 | Bacteria | 4292 |
| 86 | Ga0466707_198906 | 3300042601 | Bacteria | 7249 |
| 87 | JGI24705J35276_12236104 | 3300002504 | Bacteria | 7473 |
| 88 | JGI24696J40584_12952230 | 3300002834 | Bacteria | 2322 |
| 89 | Ga0466705_138420 | 3300042612 | Bacteria | 16498 |
| 90 | Ga0466705_304580 | 3300042612 | Bacteria | 14051 |
| 91 | Ga0466702_374863 | 3300042635 | Bacteria | 1344 |
| 92 | Ga0466704_203613 | 3300042643 | Bacteria | 26975 |
| 93 | Ga0466708_040671 | 3300042652 | Bacteria | 12373 |
| 94 | Ga0466711_034469 | 3300042615 | Bacteria | 9331 |
| 95 | Ga0466711_119372 | 3300042615 | Bacteria | 3782 |
| 96 | Ga0466711_216103 | 3300042615 | Bacteria | 4568 |
| 97 | Ga0466723_190901 | 3300042618 | Bacteria | 2827 |
| 98 | Ga0466723_283014 | 3300042618 | Bacteria | 3431 |
| 99 | Ga0466690_006181 | 3300042590 | Bacteria | 2507 |
| 100 | Ga0466692_128848 | 3300042591 | Bacteria | 2222 |
| 101 | Ga0466691_122433 | 3300042593 | Bacteria | 17775 |
| 102 | Ga0123355_10000670 | 3300009826 | Bacteria | 46440 |
| 103 | Ga0123355_10085664 | 3300009826 | Bacteria | 5013 |
| 104 | Ga0123356_10029938 | 3300010049 | Bacteria | 5096 |
| 105 | Ga0123353_10005157 | 3300010167 | Bacteria | 17055 |
| 106 | Ga0466714_010576 | 3300042603 | Bacteria | 6110 |
| 107 | Ga0466716_147903 | 3300042605 | Bacteria | 3844 |
| 108 | Ga0466719_011950 | 3300042606 | Bacteria | 7299 |
| 109 | Ga0466698_001506 | 3300042610 | Bacteria | 2729 |
| 110 | IMNBL1DRAFT_c0013811 | 3300000062 | Bacteria | 3597 |
| 111 | JGI24702J35022_10031548 | 3300002462 | Bacteria | 2839 |
| 112 | Ga0466705_085100 | 3300042612 | Bacteria | 20909 |
| 113 | Ga0466735_158923 | 3300042624 | Bacteria | 1788 |
| 114 | Ga0466703_160377 | 3300042636 | Bacteria | 1201 |
| 115 | Ga0466704_591460 | 3300042643 | Bacteria | 1963 |
| 116 | Ga0466709_414293 | 3300042648 | Bacteria | 2742 |
| 117 | Ga0466727_111536 | 3300042655 | Bacteria | 3541 |
| 118 | Ga0466727_231439 | 3300042655 | Bacteria | 1282 |
| 119 | Ga0466723_335952 | 3300042618 | Bacteria | 5746 |
| 120 | Ga0466692_134892 | 3300042591 | Bacteria | 15074 |
| 121 | Ga0123355_10133709 | 3300009826 | Bacteria | 3815 |
| 122 | Ga0123355_10442604 | 3300009826 | Bacteria | 1644 |
| 123 | Ga0123353_10057906 | 3300010167 | Bacteria | 6208 |
| 124 | Ga0123353_10158502 | 3300010167 | Bacteria | 3605 |
| 125 | Ga0123353_10249330 | 3300010167 | Bacteria | 2752 |
| 126 | Ga0466707_197933 | 3300042601 | Bacteria | 1869 |
| 127 | Ga0466698_171278 | 3300042610 | Bacteria | 3210 |
| 128 | JGI24695J34938_10019212 | 3300002450 | Bacteria | 3394 |
| 129 | Ga0068302_10013259 | 3300005071 | Bacteria | 2017 |
| 130 | Ga0072941_1007884 | 3300005201 | Bacteria | 4080 |
| 131 | Ga0466705_248397 | 3300042612 | Bacteria | 5323 |
| 132 | Ga0466704_450214 | 3300042643 | Bacteria | 4288 |
| 133 | Ga0466708_013549 | 3300042652 | Bacteria | 36158 |
| 134 | Ga0466708_064183 | 3300042652 | Bacteria | 6402 |
| 135 | Ga0466725_177498 | 3300042654 | Bacteria | 1247 |
| 136 | Ga0466727_054853 | 3300042655 | Bacteria | 6577 |
| 137 | Ga0466727_275313 | 3300042655 | Bacteria | 2971 |
| 138 | Ga0466727_325935 | 3300042655 | Unclassified | 1123 |
| 139 | Ga0466705_402034 | 3300042612 | Bacteria | 3471 |
| 140 | Ga0466705_510726 | 3300042612 | Bacteria | 20190 |
| 141 | Ga0466715_322688 | 3300042616 | Bacteria | 12835 |
| 142 | Ga0466726_207638 | 3300042619 | Bacteria | 9318 |
| 143 | Ga0415639_006831 | 3300038395 | Bacteria | 15597 |
| 144 | Ga0415639_080040 | 3300038395 | Unclassified | 1501 |
| 145 | Ga0466693_264485 | 3300042592 | Bacteria | 2270 |
| 146 | Ga0466699_082067 | 3300042597 | Bacteria | 2181 |
| 147 | Ga0123355_10411491 | 3300009826 | Bacteria | 1736 |
| 148 | Ga0123353_10440105 | 3300010167 | Bacteria | 1923 |
| 149 | Ga0466701_096890 | 3300042598 | Unclassified | 80799 |
| 150 | Ga0466700_266826 | 3300042600 | Bacteria | 1634 |
| 151 | Ga0466707_024328 | 3300042601 | Bacteria | 7147 |
| 152 | Ga0466719_031824 | 3300042606 | Bacteria | 1718 |
| 153 | Ga0466720_064995 | 3300042607 | Bacteria | 1548 |
| 154 | Ga0466705_315643 | 3300042612 | Unclassified | 2505 |
| 155 | Ga0466733_209914 | 3300042659 | Bacteria | 4333 |
| 156 | Ga0466727_193892 | 3300042655 | Unclassified | 1152 |
| 157 | Ga0466705_504309 | 3300042612 | Bacteria | 3569 |
| 158 | Ga0466711_026574 | 3300042615 | Unclassified | 2867 |
| 159 | Ga0466723_328288 | 3300042618 | Bacteria | 3221 |
| 160 | Ga0466726_307276 | 3300042619 | Bacteria | 1763 |
| 161 | Ga0466728_264619 | 3300042620 | Bacteria | 3993 |
| 162 | Ga0415639_042537 | 3300038395 | Bacteria | 8661 |
| 163 | Ga0415639_150833 | 3300038395 | Bacteria | 1936 |
| 164 | Ga0466690_041909 | 3300042590 | Unclassified | 1996 |
| 165 | Ga0466693_343679 | 3300042592 | Bacteria | 1432 |
| 166 | Ga0466696_432990 | 3300042596 | Bacteria | 9144 |
| 167 | Ga0123357_10279931 | 3300009784 | Bacteria | 1725 |
| 168 | Ga0123353_10296693 | 3300010167 | Unclassified | 2471 |
| 169 | Ga0123353_10700607 | 3300010167 | Bacteria | 1421 |
| 170 | Ga0123354_10209745 | 3300010882 | Bacteria | 2110 |
| 171 | JGI24702J35022_10019748 | 3300002462 | Bacteria | 3664 |
| 172 | JGI24702J35022_10043774 | 3300002462 | Bacteria | 2385 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.