Protein Family IF05172
Metagenome
Isolate
294
Members
192
Samples
178
Scaffolds
258.39
Avg Length
Representative Sequence
- ID
- 3300042596|Ga0466696_187103|Ga0466696_187103_8559_9479
- Length
- 306 aa
- Sequence
- MFAAFCQFPVRNKKSLLFLYWTTVIIKQETNNANDKLCQAAAPSPKGDIPLKILTLNINSIRAHAESFLDILRRGEYDVVLVQELKVETANFPHNLFDEYGYNIKVFGQKSYNGVAVLSKYSIEDAAYGLPNYADTNARLLECVIDGRLRIINAYMPNGESVDSPKFPYKIEWMEHFTKHIEKYLNCEEAVILAGDFNVAIQDRDVWDPAAYRGSSISAPAARAIMQRWLDAGWLDVWRHLHPDDTGYTWYGYRGGNNVEKNHGLRLDYFLANRAAAELIKGCEIDLEPRLAPKPTDHTGLMLSVK
Sample Types
Isolate
39.5%
Metagenome
60.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
37.2%
Unclassified
10.9%
Ixodidae
10.4%
Formicidae
9.3%
Termitidae
9.3%
Kalotermitidae
6.6%
Armadillidiidae
4.4%
Culicidae
3.8%
Rhinotermitidae
1.6%
Curculionidae
1.1%
Elmidae
1.1%
Termopsidae
1.1%
Nephropidae
0.5%
Hodotermitidae
0.5%
Pseudococcidae
0.5%
Ceratopogonidae
0.5%
Crambidae
0.5%
Alydidae
0.5%
Taxonomy
Archaea
0
Bacteria
270
Eukaryota
0
Viruses
0
Unclassified
24
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 2 | 2684622927 | Snodgrassella alvi Sa_196 | Isolate | Unclassified |
| 3 | 2609460328 | Candidatus Hepatobacter penaei NHPB | Isolate | Unclassified |
| 4 | 2811995359 | Rickettsia bellii An04 | Isolate | Ixodidae |
| 5 | 2837563510 | Snodgrassella alvi N-S1 | Isolate | Apidae |
| 6 | 2839785767 | Thalassobius sp. I31.1 | Isolate | Nephropidae |
| 7 | 2843299038 | Snodgrassella alvi N-S2 | Isolate | Apidae |
| 8 | 2846368606 | Snodgrassella alvi A-11-12 | Isolate | Apidae |
| 9 | 2849404451 | Snodgrassella alvi E1 | Isolate | Apidae |
| 10 | 2854088767 | Snodgrassella alvi MS1-3 | Isolate | Apidae |
| 11 | 2854104879 | Snodgrassella alvi Fer2-2 | Isolate | Apidae |
| 12 | 2857840086 | Snodgrassella alvi Aw-20 | Isolate | Apidae |
| 13 | 2868461634 | Snodgrassella alvi Gris2-3-4 | Isolate | Apidae |
| 14 | 640753044 | Rickettsia bellii OSU 85-389 | Isolate | Ixodidae |
| 15 | 644736403 | Rickettsia peacockii Rustic | Isolate | Ixodidae |
| 16 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 17 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 18 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 19 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 20 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 21 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 22 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 23 | 8119099601 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 24 | 2548876780 | Rickettsia sibirica BJ-90 | Isolate | Ixodidae |
| 25 | 2585428136 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 26 | 2806310572 | Pukyongiella litopenaei SH-1 | Isolate | Unclassified |
| 27 | 2854100132 | Snodgrassella alvi A-2-12 | Isolate | Apidae |
| 28 | 2855972776 | Rickettsia colombianensi Adcor 2 | Isolate | Ixodidae |
| 29 | 2857827427 | Snodgrassella alvi App6-4 | Isolate | Apidae |
| 30 | 2857832487 | Snodgrassella alvi HK9x | Isolate | Apidae |
| 31 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 32 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 33 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 34 | 650716015 | Candidatus Midichloria mitochondrii IricVA | Isolate | Ixodidae |
| 35 | 8101270055 | Snodgrassella sp. W8124 | Isolate | Apidae |
| 36 | 8101278866 | Snodgrassella sp. W6238H11 | Isolate | Apidae |
| 37 | 8068887342 | Rickettsia asiatica Maytaro1284 | Isolate | Ixodidae |
| 38 | 3300000475 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-J21 | Metagenome | Apidae |
| 39 | 3300002732 | Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs | Metagenome | |
| 40 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 41 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 42 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 43 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 44 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 45 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 46 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 47 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 48 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 49 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 50 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 51 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 52 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 53 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 54 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 55 | 2548876789 | Xanthomonas sacchari NCPPB 4393 | Isolate | |
| 56 | 2681813507 | Insolitispirillum peregrinum integrum DSM 11589 | Isolate | Unclassified |
| 57 | 2811994999 | Candidatus Rickettsia amblyommii An13 | Isolate | Ixodidae |
| 58 | 2820093073 | Unclassified Proteobacteria Lab288P3bin233 | Isolate | Unclassified |
| 59 | 2820141685 | Unclassified Proteobacteria Emb289P3bin118 | Isolate | Unclassified |
| 60 | 2820067954 | Unclassified Proteobacteria Nt197P3bin44 | Isolate | Unclassified |
| 61 | 2834762790 | Rickettsia fournieri AUS118 | Isolate | Unclassified |
| 62 | 2846376288 | Snodgrassella alvi Fer4-2 | Isolate | Apidae |
| 63 | 2846379220 | Snodgrassella alvi wkB237 | Isolate | Apidae |
| 64 | 2849399727 | Snodgrassella alvi Fer1-2 | Isolate | Apidae |
| 65 | 2849402121 | Snodgrassella alvi A-10-12 | Isolate | Apidae |
| 66 | 2849409164 | Snodgrassella alvi wkB298 | Isolate | Apidae |
| 67 | 2849413536 | Snodgrassella alvi N-S4 | Isolate | Apidae |
| 68 | 2854091108 | Snodgrassella alvi wkB339 | Isolate | Apidae |
| 69 | 2854095577 | Snodgrassella alvi A12 | Isolate | Apidae |
| 70 | 2857837414 | Snodgrassella alvi App4-8 | Isolate | Apidae |
| 71 | 638341178 | Rickettsia sibirica 246 | Isolate | Unclassified |
| 72 | 650716082 | Rickettsia conorii heilongjiangensis 054 | Isolate | Pseudococcidae |
| 73 | 8101272231 | Snodgrassella sp. W8132 | Isolate | Apidae |
| 74 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 75 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 76 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 77 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 78 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 79 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 80 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 81 | 2582581025 | Rickettsia tamurae buchneri ISO7 | Isolate | Ixodidae |
| 82 | 2718217968 | Rickettsia rickettsii Iowa Small Clone | Isolate | Ixodidae |
| 83 | 2837560943 | Snodgrassella alvi HK3 | Isolate | Apidae |
| 84 | 2840743474 | Snodgrassella alvi N-23 | Isolate | Apidae |
| 85 | 2846366200 | Snodgrassella alvi Gris3-4 | Isolate | Apidae |
| 86 | 2846370940 | Snodgrassella alvi Nev3CBA3 | Isolate | Apidae |
| 87 | 2857842411 | Snodgrassella alvi Ruf1-X | Isolate | Apidae |
| 88 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 89 | 2864761044 | Stenotrophomonas rhizophilia S00008 | Isolate | Elmidae |
| 90 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 91 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 92 | 644736402 | Rickettsia africae ESF-5 | Isolate | Ixodidae |
| 93 | 8101255641 | Snodgrassella sp. M0110 | Isolate | Apidae |
| 94 | 8101260589 | Snodgrassella sp. M0118 | Isolate | Apidae |
| 95 | 8101267702 | Snodgrassella sp. W6238H14 | Isolate | Apidae |
| 96 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 97 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 98 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 99 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 100 | 2585427850 | Snodgrassella alvi wkB12 | Isolate | Apidae |
| 101 | 2718218151 | Rickettsia rickettsii Iowa Large Clone | Isolate | Ixodidae |
| 102 | 2811994808 | Snodgrassella alvi Sa_196 v2 | Isolate | Unclassified |
| 103 | 2820641689 | Unclassified Firmicutes Cu122P5bin5 | Isolate | Unclassified |
| 104 | 2846361553 | Snodgrassella alvi PEB0171 | Isolate | Apidae |
| 105 | 2849417936 | Snodgrassella alvi N9 | Isolate | Apidae |
| 106 | 2852205774 | Snodgrassella alvi ESL0196 | Isolate | Apidae |
| 107 | 2854086477 | Snodgrassella alvi N-S3 | Isolate | Apidae |
| 108 | 2854097802 | Snodgrassella alvi Aw-18 | Isolate | Apidae |
| 109 | 2963630348 | Burkholderiales bacterium 3487_49 | Isolate | Formicidae |
| 110 | 2821312900 | Unclassified Proteobacteria Lab288P4bin16 | Isolate | Unclassified |
| 111 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 112 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 113 | 640753045 | Rickettsia canadensis McKiel | Isolate | Ixodidae |
| 114 | 641228503 | Rickettsia massiliae MTU5 | Isolate | Ixodidae |
| 115 | 8101265296 | Snodgrassella sp. W8158 | Isolate | Apidae |
| 116 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 117 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 118 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 119 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 120 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 121 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 122 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 123 | 2548876922 | Rickettsia sibirica mongolitimonae HA-91 | Isolate | Ixodidae |
| 124 | 2556921622 | Terasakiella pusilla DSM 6293 | Isolate | Unclassified |
| 125 | 2597489904 | Rickettsia helvetica C9P9 | Isolate | Ixodidae |
| 126 | 2599185121 | Rickettsiales bacterium Ac37b | Isolate | Ixodidae |
| 127 | 2511231061 | Rickettsia slovaca 13-B | Isolate | Ixodidae |
| 128 | 2820154698 | Unclassified Proteobacteria Cu122P5bin26 | Isolate | Unclassified |
| 129 | 2820176377 | Unclassified Planctomycetes Th196P3bin111 | Isolate | Unclassified |
| 130 | 2834412944 | Snodgrassella alvi A-5-24 | Isolate | Apidae |
| 131 | 2834415282 | Snodgrassella alvi Occ4-2 | Isolate | Apidae |
| 132 | 2834764525 | Rickettsia endosymbiont of Culicoides newsteadi RiCNE | Isolate | Ceratopogonidae |
| 133 | 2846359427 | Snodgrassella alvi wkB273 | Isolate | Apidae |
| 134 | 2848339753 | Ephemeroptericola cinctiostellae F02 | Isolate | Unclassified |
| 135 | 2857825141 | Snodgrassella alvi wkB332 | Isolate | Apidae |
| 136 | 2857830159 | Snodgrassella alvi A-9-24 | Isolate | Apidae |
| 137 | 2868464004 | Snodgrassella alvi Pens2-2-5 | Isolate | Apidae |
| 138 | 8101258116 | Snodgrassella sp. M0112 | Isolate | Apidae |
| 139 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 140 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 141 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 142 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 143 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 144 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 145 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 146 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 147 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 148 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 149 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 150 | 2820094617 | Unclassified Proteobacteria Lab288P3bin216 | Isolate | Unclassified |
| 151 | 2820082748 | Unclassified Proteobacteria Lab288P4bin14 | Isolate | Unclassified |
| 152 | 2840748007 | Snodgrassella alvi A-1-12 | Isolate | Apidae |
| 153 | 2843301220 | Snodgrassella alvi Nev4-2 | Isolate | Apidae |
| 154 | 2846363972 | Snodgrassella alvi N-W7 | Isolate | Apidae |
| 155 | 2849406737 | Snodgrassella alvi PEB0178 | Isolate | Apidae |
| 156 | 2849415715 | Snodgrassella alvi A2 | Isolate | Apidae |
| 157 | 2857822956 | Snodgrassella alvi N-W4 | Isolate | Apidae |
| 158 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 159 | 8101263066 | Snodgrassella sp. M0351 | Isolate | Apidae |
| 160 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 161 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 162 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 163 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 164 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 165 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 166 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 167 | 2571042003 | Stenoxybacter acetivorans DSM 19021 | Isolate | Rhinotermitidae |
| 168 | 2585427851 | Snodgrassella alvi wkB29 | Isolate | Apidae |
| 169 | 2820092068 | Unclassified Proteobacteria Lab288P3bin38 | Isolate | Unclassified |
| 170 | 2841330038 | Sulfitobacter sp. D7 | Isolate | |
| 171 | 2846373876 | Snodgrassella alvi Gris1-3 | Isolate | Apidae |
| 172 | 2848751009 | Snodgrassella alvi App2-2 | Isolate | Apidae |
| 173 | 2849411303 | Snodgrassella alvi A3 | Isolate | Apidae |
| 174 | 2854084220 | Snodgrassella alvi Snod2-1-5 | Isolate | Apidae |
| 175 | 2854093395 | Snodgrassella alvi N-S5 | Isolate | Apidae |
| 176 | 2854102457 | Snodgrassella alvi Gris1-6 | Isolate | Apidae |
| 177 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 178 | 2857835046 | Snodgrassella alvi wkB9 | Isolate | Apidae |
| 179 | 2857845033 | Snodgrassella alvi WF3-3 | Isolate | Apidae |
| 180 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 181 | 647533204 | Rickettsia endosymbiont of Ixodes scapularis | Isolate | Ixodidae |
| 182 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 183 | 8101274435 | Snodgrassella sp. W8134 | Isolate | Apidae |
| 184 | 8101276651 | Snodgrassella sp. W8135 | Isolate | Apidae |
| 185 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 186 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 187 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 188 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 189 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 190 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 191 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 192 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466734_106197 | 3300042623 | Bacteria | 8267 |
| 2 | Ga0466730_039236 | 3300042625 | Bacteria | 21569 |
| 3 | Ga0466703_020897 | 3300042636 | Bacteria | 5417 |
| 4 | Ga0466703_120977 | 3300042636 | Bacteria | 86906 |
| 5 | Ga0466703_146648 | 3300042636 | Bacteria | 10645 |
| 6 | Ga0466704_069026 | 3300042643 | Bacteria | 151421 |
| 7 | Ga0466704_157198 | 3300042643 | Bacteria | 1551 |
| 8 | Ga0466725_417952 | 3300042654 | Bacteria | 1187 |
| 9 | Ga0160467_100996 | 3300012829 | Bacteria | 15604 |
| 10 | Ga0160455_100224 | 3300012837 | Unclassified | 46858 |
| 11 | Ga0160436_1000302 | 3300012861 | Bacteria | 21900 |
| 12 | Ga0466690_142924 | 3300042590 | Bacteria | 2769 |
| 13 | Ga0466690_163139 | 3300042590 | Bacteria | 13797 |
| 14 | Ga0466696_177497 | 3300042596 | Bacteria | 2327 |
| 15 | Ga0123357_10213375 | 3300009784 | Bacteria | 2162 |
| 16 | Ga0123356_11036245 | 3300010049 | Bacteria | 990 |
| 17 | Ga0123353_10101888 | 3300010167 | Bacteria | 4628 |
| 18 | Ga0123354_10007807 | 3300010882 | Bacteria | 16197 |
| 19 | Ga0466705_473308 | 3300042612 | Bacteria | 1254 |
| 20 | Ga0466705_525070 | 3300042612 | Bacteria | 1198 |
| 21 | Ga0466711_330598 | 3300042615 | Unclassified | 8133 |
| 22 | Ga0466715_087157 | 3300042616 | Bacteria | 1793 |
| 23 | Ga0466715_329257 | 3300042616 | Bacteria | 8271 |
| 24 | Ga0103265_1004785 | 3300007068 | Bacteria | 2586 |
| 25 | Ga0102737_1002457 | 3300007142 | Bacteria | 4579 |
| 26 | Ga0103264_1024301 | 3300007188 | Bacteria | 4555 |
| 27 | Ga0103268_1007177 | 3300007192 | Bacteria | 2273 |
| 28 | Ga0466714_052996 | 3300042603 | Bacteria | 6848 |
| 29 | Ga0466705_263620 | 3300042612 | Bacteria | 45214 |
| 30 | Ga0160468_100138 | 3300012819 | Bacteria | 69266 |
| 31 | Ga0160446_100999 | 3300012835 | Unclassified | 7308 |
| 32 | Ga0160472_100264 | 3300012839 | Bacteria | 59402 |
| 33 | Ga0160436_1010442 | 3300012861 | Unclassified | 2019 |
| 34 | Ga0415639_132878 | 3300038395 | Unclassified | 2691 |
| 35 | Ga0466696_278603 | 3300042596 | Bacteria | 1360 |
| 36 | Ga0466696_436738 | 3300042596 | Bacteria | 40310 |
| 37 | Ga0466728_439412 | 3300042620 | Bacteria | 5260 |
| 38 | HBC_ctgsDRAFT_1017814 | 3300000333 | Bacteria | 1729 |
| 39 | CVPL010W_10005480 | 3300002931 | Bacteria | 13747 |
| 40 | Ga0103266_1000437 | 3300007067 | Bacteria | 14768 |
| 41 | Ga0103260_1000020 | 3300007139 | Bacteria | 70191 |
| 42 | Ga0103260_1000335 | 3300007139 | Bacteria | 10480 |
| 43 | Ga0102737_1001103 | 3300007142 | Unclassified | 7903 |
| 44 | Ga0103268_1000966 | 3300007192 | Bacteria | 7732 |
| 45 | Ga0466722_108785 | 3300042609 | Bacteria | 25644 |
| 46 | Ga0466703_173930 | 3300042636 | Bacteria | 1372 |
| 47 | Ga0466704_374471 | 3300042643 | Bacteria | 20115 |
| 48 | Ga0466727_084815 | 3300042655 | Bacteria | 4374 |
| 49 | Ga0160458_100062 | 3300012832 | Bacteria | 138330 |
| 50 | Ga0466696_124546 | 3300042596 | Bacteria | 69301 |
| 51 | Ga0466712_097469 | 3300042614 | Unclassified | 1023 |
| 52 | Ga0466715_274370 | 3300042616 | Bacteria | 4347 |
| 53 | WW0001_100341 | 3300002732 | Bacteria | 2250 |
| 54 | CVPL005L_10000278 | 3300002938 | Bacteria | 72520 |
| 55 | Ga0074278_118245 | 3300005721 | Bacteria | 1953 |
| 56 | Ga0102740_1000019 | 3300007140 | Bacteria | 42994 |
| 57 | Ga0102738_1000172 | 3300007141 | Bacteria | 15684 |
| 58 | Ga0102737_1000054 | 3300007142 | Bacteria | 34075 |
| 59 | Ga0103264_1000922 | 3300007188 | Bacteria | 13223 |
| 60 | Ga0466706_148875 | 3300042599 | Bacteria | 2527 |
| 61 | Ga0466719_237936 | 3300042606 | Bacteria | 1849 |
| 62 | Ga0466725_325852 | 3300042654 | Bacteria | 3116 |
| 63 | Ga0160433_114426 | 3300012846 | Bacteria | 977 |
| 64 | Ga0160434_100826 | 3300012850 | Bacteria | 6800 |
| 65 | Ga0160457_1001585 | 3300012858 | Unclassified | 6038 |
| 66 | Ga0123356_10015422 | 3300010049 | Bacteria | 7327 |
| 67 | Ga0123356_10954610 | 3300010049 | Bacteria | 1028 |
| 68 | Ga0123353_10058284 | 3300010167 | Bacteria | 6187 |
| 69 | Ga0123353_10098029 | 3300010167 | Bacteria | 4724 |
| 70 | Ga0123353_10250253 | 3300010167 | Bacteria | 2745 |
| 71 | Ga0160454_100113 | 3300012798 | Bacteria | 100176 |
| 72 | Ga0466705_486913 | 3300042612 | Bacteria | 122328 |
| 73 | SPBB_contig05903 | 2044078006 | Unclassified | 2582 |
| 74 | CVPL010W_10009141 | 3300002931 | Bacteria | 12236 |
| 75 | Ga0102736_1005876 | 3300007052 | Bacteria | 1542 |
| 76 | Ga0103265_1000050 | 3300007068 | Bacteria | 16320 |
| 77 | Ga0102735_1000484 | 3300007080 | Bacteria | 9005 |
| 78 | Ga0102739_1003420 | 3300007095 | Bacteria | 2325 |
| 79 | Ga0102734_1010832 | 3300007129 | Bacteria | 2128 |
| 80 | Ga0102738_1000016 | 3300007141 | Bacteria | 88310 |
| 81 | Ga0102738_1007141 | 3300007141 | Unclassified | 1545 |
| 82 | Ga0102738_1008874 | 3300007141 | Bacteria | 1381 |
| 83 | Ga0102737_1000852 | 3300007142 | Bacteria | 9391 |
| 84 | Ga0102737_1003675 | 3300007142 | Bacteria | 3443 |
| 85 | Ga0103264_1000193 | 3300007188 | Bacteria | 58174 |
| 86 | Ga0105524_102461 | 3300007733 | Bacteria | 7073 |
| 87 | Ga0466705_233332 | 3300042612 | Bacteria | 4752 |
| 88 | Ga0466703_085138 | 3300042636 | Bacteria | 3101 |
| 89 | Ga0466724_14460 | 3300042649 | Unclassified | 1130 |
| 90 | Ga0466708_403869 | 3300042652 | Bacteria | 2342 |
| 91 | Ga0466725_128243 | 3300042654 | Bacteria | 12719 |
| 92 | Ga0160469_101238 | 3300012824 | Unclassified | 7359 |
| 93 | Ga0160431_100388 | 3300012828 | Unclassified | 21640 |
| 94 | Ga0160444_100046 | 3300012841 | Bacteria | 184280 |
| 95 | Ga0160444_100162 | 3300012841 | Bacteria | 65903 |
| 96 | Ga0160443_100693 | 3300012848 | Unclassified | 18500 |
| 97 | Ga0415639_059087 | 3300038395 | Bacteria | 1800 |
| 98 | Ga0466657_211515 | 3300042582 | Bacteria | 2485 |
| 99 | Ga0466693_045729 | 3300042592 | Bacteria | 1040 |
| 100 | Ga0466691_096246 | 3300042593 | Bacteria | 39034 |
| 101 | Ga0123353_10202743 | 3300010167 | Bacteria | 3119 |
| 102 | Ga0123353_10247976 | 3300010167 | Bacteria | 2761 |
| 103 | Ga0466712_142453 | 3300042614 | Bacteria | 16097 |
| 104 | Ga0466723_028157 | 3300042618 | Bacteria | 2002 |
| 105 | Ga0466723_344507 | 3300042618 | Bacteria | 3502 |
| 106 | Ga0466728_391888 | 3300042620 | Bacteria | 1712 |
| 107 | DPOL_contig16534 | 2035918003 | Bacteria | 3598 |
| 108 | AustNasuHG_c1024472 | 3300000089 | Bacteria | 1912 |
| 109 | Ga0102736_1000051 | 3300007052 | Bacteria | 111370 |
| 110 | Ga0103260_1005051 | 3300007139 | Bacteria | 1967 |
| 111 | Ga0466701_079869 | 3300042598 | Bacteria | 66058 |
| 112 | Ga0466720_197784 | 3300042607 | Bacteria | 7303 |
| 113 | Ga0160472_100885 | 3300012839 | Bacteria | 11920 |
| 114 | Ga0160444_101444 | 3300012841 | Bacteria | 4534 |
| 115 | Ga0160434_111506 | 3300012850 | Unclassified | 1429 |
| 116 | Ga0466696_187103 | 3300042596 | Bacteria | 12150 |
| 117 | Ga0466705_459649 | 3300042612 | Bacteria | 4620 |
| 118 | Ga0466715_123242 | 3300042616 | Bacteria | 6176 |
| 119 | Ga0466723_281114 | 3300042618 | Bacteria | 8171 |
| 120 | CVPL010W_10006961 | 3300002931 | Bacteria | 11344 |
| 121 | CVPL005L_10029586 | 3300002938 | Unclassified | 3364 |
| 122 | Ga0103265_1004685 | 3300007068 | Bacteria | 1929 |
| 123 | Ga0103261_1010741 | 3300007083 | Bacteria | 1278 |
| 124 | Ga0102737_1001512 | 3300007142 | Bacteria | 6403 |
| 125 | Ga0103268_1000728 | 3300007192 | Bacteria | 9338 |
| 126 | Ga0103268_1017022 | 3300007192 | Bacteria | 1601 |
| 127 | Ga0466706_026525 | 3300042599 | Bacteria | 4370 |
| 128 | Ga0466706_285493 | 3300042599 | Bacteria | 25752 |
| 129 | Ga0466719_041828 | 3300042606 | Bacteria | 1563 |
| 130 | Ga0466708_243805 | 3300042652 | Bacteria | 2980 |
| 131 | Ga0160468_100268 | 3300012819 | Unclassified | 26836 |
| 132 | Ga0160446_100409 | 3300012835 | Bacteria | 20700 |
| 133 | Ga0160444_100005 | 3300012841 | Bacteria | 646301 |
| 134 | Ga0160435_1000110 | 3300012857 | Bacteria | 47176 |
| 135 | Ga0466690_180746 | 3300042590 | Bacteria | 4690 |
| 136 | Ga0466696_386092 | 3300042596 | Bacteria | 2123 |
| 137 | Ga0123355_10630577 | 3300009826 | Bacteria | 1259 |
| 138 | Ga0160466_100015 | 3300012809 | Bacteria | 362120 |
| 139 | Ga0466723_250734 | 3300042618 | Bacteria | 7764 |
| 140 | Ga0466729_119594 | 3300042621 | Bacteria | 4575 |
| 141 | SCG598J21_12961 | 3300000475 | Bacteria | 42685 |
| 142 | CVPL010W_10016021 | 3300002931 | Bacteria | 6728 |
| 143 | Ga0103266_1000338 | 3300007067 | Bacteria | 12830 |
| 144 | Ga0103266_1005239 | 3300007067 | Bacteria | 1688 |
| 145 | Ga0103261_1004196 | 3300007083 | Unclassified | 2183 |
| 146 | Ga0103267_1029130 | 3300007190 | Bacteria | 1843 |
| 147 | Ga0466706_050349 | 3300042599 | Bacteria | 77240 |
| 148 | Ga0466705_057149 | 3300042612 | Bacteria | 12558 |
| 149 | Ga0466703_232988 | 3300042636 | Unclassified | 4309 |
| 150 | Ga0466708_046550 | 3300042652 | Unclassified | 1527 |
| 151 | Ga0466725_107518 | 3300042654 | Bacteria | 74412 |
| 152 | Ga0160459_100047 | 3300012831 | Unclassified | 190135 |
| 153 | Ga0160446_104207 | 3300012835 | Bacteria | 2166 |
| 154 | Ga0160430_100022 | 3300012852 | Bacteria | 219260 |
| 155 | Ga0160457_1000034 | 3300012858 | Bacteria | 244617 |
| 156 | Ga0264413_100829 | 3300024493 | Bacteria | 149693 |
| 157 | Ga0415639_249066 | 3300038395 | Unclassified | 2044 |
| 158 | Ga0466691_163929 | 3300042593 | Unclassified | 1708 |
| 159 | Ga0123356_10005602 | 3300010049 | Bacteria | 12770 |
| 160 | Ga0123353_10000706 | 3300010167 | Bacteria | 40716 |
| 161 | Ga0466705_389327 | 3300042612 | Bacteria | 14011 |
| 162 | Ga0466715_413862 | 3300042616 | Bacteria | 54460 |
| 163 | Ga0466726_367124 | 3300042619 | Bacteria | 27656 |
| 164 | Ga0466728_336063 | 3300042620 | Bacteria | 38982 |
| 165 | Ga0466728_448300 | 3300042620 | Bacteria | 12402 |
| 166 | Ga0466729_109201 | 3300042621 | Bacteria | 8328 |
| 167 | CVPL005L_10000002 | 3300002938 | Bacteria | 360643 |
| 168 | Ga0102736_1000225 | 3300007052 | Bacteria | 12988 |
| 169 | Ga0102736_1000857 | 3300007052 | Bacteria | 5659 |
| 170 | Ga0102736_1001050 | 3300007052 | Bacteria | 8128 |
| 171 | Ga0103261_1001947 | 3300007083 | Unclassified | 5435 |
| 172 | Ga0103260_1000518 | 3300007139 | Bacteria | 7386 |
| 173 | Ga0102740_1000002 | 3300007140 | Bacteria | 127048 |
| 174 | Ga0102740_1002484 | 3300007140 | Bacteria | 4221 |
| 175 | Ga0102738_1000212 | 3300007141 | Bacteria | 12158 |
| 176 | Ga0102738_1001200 | 3300007141 | Bacteria | 4073 |
| 177 | Ga0103267_1007917 | 3300007190 | Bacteria | 3117 |
| 178 | Ga0103267_1085481 | 3300007190 | Bacteria | 928 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03372 | Exo_endo_phos | Endonuclease/Exonuclease/phosphatase family | 54 | 298 | 0.91 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF03372 | GO:0003824 | catalytic activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.