Protein Family IF05130
Metagenome
Metatranscriptome
Isolate
431
Members
105
Samples
394
Scaffolds
496.16
Avg Length
Representative Sequence
- ID
- 3300042596|Ga0466696_086787|Ga0466696_086787_945_2537
- Length
- 530 aa
- Sequence
- MGLEETLKNVLKERRRCETARIETSGGIGMIDLKKYEFWFIVGSQDLYGEETLRQVEANARIMADEFAKDPLLPGTLALKPIAADPSVIRKLFAEANAAMNCAGVITWMHTFSPSKMWIQGLAANRKPLLHLHTQFNRDIPWDSIDMDFMNLNQSAHGDREHGYIHTRMRAPRKVVAGFWQDSEVRRRIGVWMRAAAARSAGIESPVMRFGDNMREVAVTEGDKVEAQMTFGWQVNTWGIGDLAARYRDAGDADAEKLVREYEDAYEFAPELASPGKERNAVLEQAKIEIALKAALASEGAGAFTTTFQDLHGLPQLPGLAVQRLMAQGYGFGAEGDWKQSMLLRSAKVMAEGLPGGVSFIEDYTYHFEPGKEAALGAHMLEVCPSIAEKKPRVEVHPLGIGGKAAPARLVFDAAPGEAALATLIDLGNRFRMIVNEIKTIPIENAMPRLPVARALWRPYPSLQEAAESWILAGGTHHSVYASALTTEHFRDWAEMMGVECVVIDKNTKPARLQDELRWSEAYWTRYGRL
Sample Types
Isolate
8.6%
Metagenome
91.2%
MAG
0.0%
Metatranscriptome
0.2%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
32.0%
Unclassified
26.0%
Kalotermitidae
14.0%
Culicidae
5.0%
Rhinotermitidae
4.0%
Armadillidiidae
4.0%
Termopsidae
3.0%
Passalidae
2.0%
Scarabaeidae
1.0%
Elmidae
1.0%
Blaberidae
1.0%
Penaeidae
1.0%
Blattidae
1.0%
Hydrophilidae
1.0%
Daphniidae
1.0%
Apidae
1.0%
Formicidae
1.0%
Hodotermitidae
1.0%
Taxonomy
Archaea
1
Bacteria
420
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 2 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 3 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 4 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 5 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 6 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 7 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 8 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 9 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 10 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 11 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 12 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 13 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 14 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 15 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 16 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 17 | 2820946191 | Unclassified Acidobacteria Nt197P3bin31 | Isolate | Unclassified |
| 18 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 19 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 20 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 21 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 22 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 23 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 24 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 25 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 26 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 27 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 28 | 2852337885 | Paenibacillus protaetiae FW100M-2 | Isolate | Scarabaeidae |
| 29 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 30 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 31 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 32 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 33 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 34 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 35 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 36 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 37 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 38 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 39 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 40 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 41 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 42 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 43 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 44 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 45 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 46 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 47 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 48 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 49 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 50 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 51 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 52 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 53 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 54 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 55 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 56 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 57 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 58 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 59 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 60 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 61 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 62 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 63 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 64 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 65 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 66 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 67 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 68 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 69 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 70 | 2593339125 | Clostridium sp. 5 | Isolate | Termitidae |
| 71 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 72 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 73 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 74 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 75 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 76 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 77 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 78 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 79 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 80 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 81 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 82 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 83 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 84 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 85 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 86 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 87 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 88 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 89 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 90 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 91 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 92 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 93 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 94 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 95 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 96 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 97 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 98 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 99 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 100 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 101 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 102 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 103 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 104 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 105 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_096212 | 3300042612 | Bacteria | 3043 |
| 2 | Ga0466705_250025 | 3300042612 | Bacteria | 7509 |
| 3 | Ga0466733_105047 | 3300042659 | Bacteria | 15161 |
| 4 | Ga0466731_091269 | 3300042622 | Bacteria | 1928 |
| 5 | Ga0466703_368469 | 3300042636 | Bacteria | 3640 |
| 6 | Ga0466704_382625 | 3300042643 | Bacteria | 2316 |
| 7 | Ga0466709_100280 | 3300042648 | Bacteria | 16965 |
| 8 | Ga0123356_10024379 | 3300010049 | Bacteria | 5694 |
| 9 | Ga0415639_258652 | 3300038395 | Bacteria | 2468 |
| 10 | Ga0466690_252597 | 3300042590 | Bacteria | 23645 |
| 11 | Ga0466692_188024 | 3300042591 | Bacteria | 12713 |
| 12 | Ga0466691_023961 | 3300042593 | Bacteria | 17173 |
| 13 | Ga0466691_142517 | 3300042593 | Bacteria | 26836 |
| 14 | Ga0466694_263262 | 3300042594 | Bacteria | 4591 |
| 15 | Ga0466696_086787 | 3300042596 | Bacteria | 4157 |
| 16 | Ga0466696_176827 | 3300042596 | Bacteria | 2959 |
| 17 | JGI24698J34947_10002601 | 3300002449 | Bacteria | 9741 |
| 18 | JGI24695J34938_10006435 | 3300002450 | Bacteria | 7053 |
| 19 | Ga0074263_106743 | 3300005485 | Bacteria | 3698 |
| 20 | Ga0074263_109552 | 3300005485 | Bacteria | 2115 |
| 21 | Ga0466712_015688 | 3300042614 | Bacteria | 16142 |
| 22 | Ga0466712_214936 | 3300042614 | Bacteria | 9864 |
| 23 | Ga0466712_253345 | 3300042614 | Bacteria | 13207 |
| 24 | Ga0466711_043533 | 3300042615 | Bacteria | 6223 |
| 25 | Ga0466718_039932 | 3300042617 | Bacteria | 1797 |
| 26 | Ga0466723_175430 | 3300042618 | Bacteria | 8042 |
| 27 | Ga0466726_017870 | 3300042619 | Bacteria | 1470 |
| 28 | Ga0466726_110394 | 3300042619 | Bacteria | 18543 |
| 29 | Ga0466726_317162 | 3300042619 | Bacteria | 11182 |
| 30 | Ga0466726_404308 | 3300042619 | Bacteria | 9418 |
| 31 | Ga0466728_139071 | 3300042620 | Bacteria | 6121 |
| 32 | Ga0466706_003960 | 3300042599 | Bacteria | 7622 |
| 33 | Ga0466706_268452 | 3300042599 | Bacteria | 2798 |
| 34 | Ga0466713_094496 | 3300042602 | Bacteria | 333875 |
| 35 | Ga0466719_376824 | 3300042606 | Bacteria | 7631 |
| 36 | Ga0466719_387198 | 3300042606 | Bacteria | 3979 |
| 37 | Ga0466720_110725 | 3300042607 | Archaea | 24728 |
| 38 | Ga0466720_219584 | 3300042607 | Bacteria | 92443 |
| 39 | Ga0466722_016049 | 3300042609 | Bacteria | 16374 |
| 40 | Ga0466722_058180 | 3300042609 | Bacteria | 8646 |
| 41 | Ga0466722_240038 | 3300042609 | Bacteria | 12390 |
| 42 | Ga0466698_068328 | 3300042610 | Bacteria | 2356 |
| 43 | Ga0466729_236979 | 3300042621 | Bacteria | 2454 |
| 44 | Ga0466735_205913 | 3300042624 | Bacteria | 18220 |
| 45 | Ga0466703_003316 | 3300042636 | Bacteria | 8999 |
| 46 | Ga0466704_025103 | 3300042643 | Bacteria | 41445 |
| 47 | Ga0466704_298474 | 3300042643 | Bacteria | 25730 |
| 48 | Ga0466704_469009 | 3300042643 | Bacteria | 5087 |
| 49 | Ga0466708_014122 | 3300042652 | Bacteria | 23560 |
| 50 | Ga0466708_372450 | 3300042652 | Bacteria | 10289 |
| 51 | Ga0123356_10007362 | 3300010049 | Bacteria | 10983 |
| 52 | Ga0123353_10003950 | 3300010167 | Bacteria | 18959 |
| 53 | Ga0123353_10034644 | 3300010167 | Bacteria | 7885 |
| 54 | Ga0123353_10035919 | 3300010167 | Bacteria | 7758 |
| 55 | Ga0160433_100024 | 3300012846 | Bacteria | 185997 |
| 56 | Ga0160445_100406 | 3300012847 | Bacteria | 23688 |
| 57 | Ga0160457_1000417 | 3300012858 | Unclassified | 21520 |
| 58 | Ga0456237_0005043 | 3300041968 | Bacteria | 2105 |
| 59 | Ga0466690_044392 | 3300042590 | Bacteria | 11453 |
| 60 | Ga0466693_152830 | 3300042592 | Bacteria | 52782 |
| 61 | Ga0466694_065842 | 3300042594 | Bacteria | 35703 |
| 62 | Ga0466694_252954 | 3300042594 | Bacteria | 25516 |
| 63 | Ga0466699_043667 | 3300042597 | Bacteria | 16827 |
| 64 | Ga0466699_078780 | 3300042597 | Bacteria | 2105 |
| 65 | AustNasuHG_c1001844 | 3300000089 | Bacteria | 7668 |
| 66 | JGI24698J34947_10002806 | 3300002449 | Bacteria | 9444 |
| 67 | JGI24698J34947_10009081 | 3300002449 | Bacteria | 5455 |
| 68 | JGI24698J34947_10019120 | 3300002449 | Unclassified | 3699 |
| 69 | JGI24695J34938_10000121 | 3300002450 | Bacteria | 70058 |
| 70 | JGI24695J34938_10000211 | 3300002450 | Bacteria | 55384 |
| 71 | JGI24695J34938_10000460 | 3300002450 | Bacteria | 39601 |
| 72 | JGI24695J34938_10001156 | 3300002450 | Bacteria | 23495 |
| 73 | JGI24695J34938_10003594 | 3300002450 | Bacteria | 10668 |
| 74 | JGI24695J34938_10011627 | 3300002450 | Bacteria | 4730 |
| 75 | JGI24702J35022_10005741 | 3300002462 | Bacteria | 7233 |
| 76 | JGI24697J35500_11263069 | 3300002507 | Bacteria | 3181 |
| 77 | Ga0466705_470027 | 3300042612 | Bacteria | 8450 |
| 78 | Ga0466712_032047 | 3300042614 | Bacteria | 4752 |
| 79 | Ga0466712_265690 | 3300042614 | Bacteria | 51797 |
| 80 | Ga0466711_067357 | 3300042615 | Bacteria | 4463 |
| 81 | Ga0466711_159327 | 3300042615 | Bacteria | 9446 |
| 82 | Ga0466711_182708 | 3300042615 | Bacteria | 4912 |
| 83 | Ga0466711_225904 | 3300042615 | Bacteria | 4535 |
| 84 | Ga0466715_097118 | 3300042616 | Bacteria | 8492 |
| 85 | Ga0466715_139556 | 3300042616 | Bacteria | 11065 |
| 86 | Ga0466715_482924 | 3300042616 | Bacteria | 13726 |
| 87 | Ga0466718_003131 | 3300042617 | Bacteria | 3908 |
| 88 | Ga0466718_086476 | 3300042617 | Bacteria | 18485 |
| 89 | Ga0466723_046824 | 3300042618 | Bacteria | 57163 |
| 90 | Ga0466723_146637 | 3300042618 | Bacteria | 10250 |
| 91 | Ga0466728_122778 | 3300042620 | Bacteria | 3260 |
| 92 | Ga0466707_384020 | 3300042601 | Bacteria | 2813 |
| 93 | Ga0466716_140503 | 3300042605 | Bacteria | 8662 |
| 94 | Ga0466720_088052 | 3300042607 | Bacteria | 4839 |
| 95 | Ga0466720_184959 | 3300042607 | Bacteria | 21554 |
| 96 | Ga0466722_001837 | 3300042609 | Bacteria | 6141 |
| 97 | Ga0466705_158665 | 3300042612 | Bacteria | 18276 |
| 98 | Ga0466731_095599 | 3300042622 | Bacteria | 1795 |
| 99 | Ga0466730_054806 | 3300042625 | Bacteria | 801523 |
| 100 | Ga0466702_243428 | 3300042635 | Bacteria | 5146 |
| 101 | Ga0466703_019141 | 3300042636 | Bacteria | 4295 |
| 102 | Ga0466703_097687 | 3300042636 | Bacteria | 2012 |
| 103 | Ga0466704_209594 | 3300042643 | Bacteria | 22501 |
| 104 | Ga0466704_320030 | 3300042643 | Bacteria | 7478 |
| 105 | Ga0466709_077345 | 3300042648 | Bacteria | 7393 |
| 106 | Ga0466709_100557 | 3300042648 | Bacteria | 7576 |
| 107 | Ga0466724_13787 | 3300042649 | Unclassified | 8454 |
| 108 | Ga0466708_091453 | 3300042652 | Bacteria | 19162 |
| 109 | Ga0466708_181251 | 3300042652 | Bacteria | 19684 |
| 110 | Ga0123356_10004829 | 3300010049 | Bacteria | 13869 |
| 111 | Ga0123356_10018759 | 3300010049 | Bacteria | 6565 |
| 112 | Ga0123353_10006942 | 3300010167 | Bacteria | 15221 |
| 113 | Ga0160445_102889 | 3300012847 | Bacteria | 3725 |
| 114 | Ga0160445_105286 | 3300012847 | Bacteria | 2225 |
| 115 | Ga0255809_1000121 | 3300022820 | Bacteria | 2009 |
| 116 | Ga0264413_105318 | 3300024493 | Bacteria | 5964 |
| 117 | Ga0466690_173311 | 3300042590 | Bacteria | 1866 |
| 118 | Ga0466692_123090 | 3300042591 | Bacteria | 15817 |
| 119 | Ga0466692_156008 | 3300042591 | Bacteria | 4936 |
| 120 | Ga0466691_075973 | 3300042593 | Bacteria | 8414 |
| 121 | Ga0466691_128635 | 3300042593 | Bacteria | 6392 |
| 122 | Ga0466691_155276 | 3300042593 | Bacteria | 3477 |
| 123 | Ga0466694_023621 | 3300042594 | Bacteria | 46663 |
| 124 | Ga0466696_411535 | 3300042596 | Bacteria | 5557 |
| 125 | IMNBL1DRAFT_c0000282 | 3300000062 | Bacteria | 44672 |
| 126 | AustNasuHG_c1024323 | 3300000089 | Unclassified | 1920 |
| 127 | JGI24698J34947_10010249 | 3300002449 | Bacteria | 5139 |
| 128 | JGI24698J34947_10010718 | 3300002449 | Bacteria | 5031 |
| 129 | JGI24698J34947_10022697 | 3300002449 | Bacteria | 3362 |
| 130 | JGI24698J34947_10031314 | 3300002449 | Bacteria | 2801 |
| 131 | JGI24695J34938_10002313 | 3300002450 | Bacteria | 14660 |
| 132 | JGI24695J34938_10007425 | 3300002450 | Bacteria | 6416 |
| 133 | Ga0466705_484798 | 3300042612 | Bacteria | 5640 |
| 134 | Ga0466712_025216 | 3300042614 | Bacteria | 25841 |
| 135 | Ga0466712_128264 | 3300042614 | Bacteria | 6723 |
| 136 | Ga0466712_190460 | 3300042614 | Bacteria | 6302 |
| 137 | Ga0466711_216896 | 3300042615 | Bacteria | 77790 |
| 138 | Ga0466711_471644 | 3300042615 | Bacteria | 39662 |
| 139 | Ga0466718_022019 | 3300042617 | Bacteria | 3643 |
| 140 | Ga0466723_008274 | 3300042618 | Bacteria | 6115 |
| 141 | Ga0466723_066143 | 3300042618 | Bacteria | 8929 |
| 142 | Ga0466706_192668 | 3300042599 | Bacteria | 87404 |
| 143 | Ga0466719_351366 | 3300042606 | Bacteria | 5914 |
| 144 | Ga0466719_571213 | 3300042606 | Bacteria | 4671 |
| 145 | Ga0466705_163948 | 3300042612 | Bacteria | 7845 |
| 146 | Ga0466705_375130 | 3300042612 | Bacteria | 6305 |
| 147 | Ga0466732_013049 | 3300042656 | Bacteria | 24009 |
| 148 | Ga0466703_098912 | 3300042636 | Bacteria | 9214 |
| 149 | Ga0466703_365931 | 3300042636 | Bacteria | 11785 |
| 150 | Ga0466703_395122 | 3300042636 | Bacteria | 51270 |
| 151 | Ga0466704_220623 | 3300042643 | Bacteria | 5370 |
| 152 | Ga0466704_276230 | 3300042643 | Bacteria | 11536 |
| 153 | Ga0466704_329828 | 3300042643 | Bacteria | 9191 |
| 154 | Ga0466708_187464 | 3300042652 | Bacteria | 7672 |
| 155 | Ga0466727_066633 | 3300042655 | Bacteria | 7427 |
| 156 | Ga0123356_10028369 | 3300010049 | Bacteria | 5244 |
| 157 | Ga0123356_10287209 | 3300010049 | Bacteria | 1744 |
| 158 | Ga0160446_100006 | 3300012835 | Bacteria | 445354 |
| 159 | Ga0160445_100607 | 3300012847 | Bacteria | 15581 |
| 160 | Ga0466690_086675 | 3300042590 | Bacteria | 50714 |
| 161 | Ga0466690_136959 | 3300042590 | Bacteria | 8886 |
| 162 | Ga0466690_250928 | 3300042590 | Bacteria | 2048 |
| 163 | Ga0466690_380487 | 3300042590 | Bacteria | 8713 |
| 164 | Ga0466690_413015 | 3300042590 | Bacteria | 12888 |
| 165 | Ga0466691_007284 | 3300042593 | Bacteria | 7504 |
| 166 | Ga0466691_085608 | 3300042593 | Bacteria | 11814 |
| 167 | Ga0466691_094074 | 3300042593 | Bacteria | 24969 |
| 168 | Ga0466691_115124 | 3300042593 | Bacteria | 8908 |
| 169 | Ga0466695_178889 | 3300042595 | Bacteria | 70582 |
| 170 | Ga0466696_150402 | 3300042596 | Bacteria | 5379 |
| 171 | Ga0466696_240501 | 3300042596 | Bacteria | 24057 |
| 172 | Ga0466696_360350 | 3300042596 | Bacteria | 6760 |
| 173 | Ga0466696_403131 | 3300042596 | Bacteria | 8142 |
| 174 | Ga0466699_301897 | 3300042597 | Bacteria | 3259 |
| 175 | Ga0466699_342051 | 3300042597 | Bacteria | 19986 |
| 176 | JGI24698J34947_10010818 | 3300002449 | Bacteria | 5009 |
| 177 | JGI24695J34938_10001964 | 3300002450 | Bacteria | 16479 |
| 178 | JGI24695J34938_10005662 | 3300002450 | Bacteria | 7719 |
| 179 | JGI24695J34938_10022964 | 3300002450 | Bacteria | 3015 |
| 180 | Ga0072941_1067677 | 3300005201 | Unclassified | 5132 |
| 181 | Ga0466712_123773 | 3300042614 | Bacteria | 5462 |
| 182 | Ga0466715_002249 | 3300042616 | Bacteria | 18745 |
| 183 | Ga0466715_482963 | 3300042616 | Bacteria | 7202 |
| 184 | Ga0466723_059599 | 3300042618 | Bacteria | 1879 |
| 185 | Ga0466723_074277 | 3300042618 | Bacteria | 17549 |
| 186 | Ga0466723_132421 | 3300042618 | Bacteria | 16358 |
| 187 | Ga0466726_029342 | 3300042619 | Bacteria | 3908 |
| 188 | Ga0466726_132684 | 3300042619 | Bacteria | 8466 |
| 189 | Ga0466728_217478 | 3300042620 | Bacteria | 3720 |
| 190 | Ga0466707_151116 | 3300042601 | Bacteria | 2586 |
| 191 | Ga0466713_104395 | 3300042602 | Bacteria | 3769 |
| 192 | Ga0466716_127791 | 3300042605 | Bacteria | 2774 |
| 193 | Ga0466720_097164 | 3300042607 | Bacteria | 17030 |
| 194 | Ga0466720_114164 | 3300042607 | Bacteria | 13602 |
| 195 | Ga0466720_183633 | 3300042607 | Bacteria | 7620 |
| 196 | Ga0466722_015349 | 3300042609 | Bacteria | 7072 |
| 197 | Ga0466722_032645 | 3300042609 | Bacteria | 5207 |
| 198 | Ga0466722_172805 | 3300042609 | Bacteria | 7569 |
| 199 | Ga0466705_094288 | 3300042612 | Bacteria | 7508 |
| 200 | Ga0466705_148373 | 3300042612 | Bacteria | 16387 |
| 201 | Ga0466705_183546 | 3300042612 | Bacteria | 8418 |
| 202 | Ga0466703_212383 | 3300042636 | Bacteria | 15812 |
| 203 | Ga0466704_089145 | 3300042643 | Bacteria | 13225 |
| 204 | Ga0466704_233462 | 3300042643 | Bacteria | 16432 |
| 205 | Ga0466704_582895 | 3300042643 | Bacteria | 4592 |
| 206 | Ga0466727_124195 | 3300042655 | Bacteria | 107642 |
| 207 | Ga0456237_0002437 | 3300041968 | Bacteria | 3013 |
| 208 | Ga0466694_051268 | 3300042594 | Bacteria | 15292 |
| 209 | Ga0466696_306970 | 3300042596 | Bacteria | 15566 |
| 210 | AustNasuHG_c1001317 | 3300000089 | Bacteria | 8908 |
| 211 | AustNasuHG_c1005809 | 3300000089 | Bacteria | 4409 |
| 212 | JGI24698J34947_10000548 | 3300002449 | Bacteria | 17805 |
| 213 | JGI24695J34938_10000225 | 3300002450 | Bacteria | 53584 |
| 214 | JGI24695J34938_10006738 | 3300002450 | Bacteria | 6838 |
| 215 | JGI24695J34938_10008220 | 3300002450 | Bacteria | 5978 |
| 216 | JGI24695J34938_10008881 | 3300002450 | Bacteria | 5676 |
| 217 | JGI24695J34938_10013928 | 3300002450 | Bacteria | 4198 |
| 218 | JGI24695J34938_10016648 | 3300002450 | Bacteria | 3731 |
| 219 | JGI24702J35022_10020646 | 3300002462 | Bacteria | 3574 |
| 220 | Ga0074263_113666 | 3300005485 | Bacteria | 6994 |
| 221 | Ga0074263_114042 | 3300005485 | Unclassified | 3535 |
| 222 | Ga0466712_029755 | 3300042614 | Unclassified | 1510 |
| 223 | Ga0466712_049264 | 3300042614 | Bacteria | 9851 |
| 224 | Ga0466715_399199 | 3300042616 | Bacteria | 12216 |
| 225 | Ga0466718_075897 | 3300042617 | Bacteria | 2012 |
| 226 | Ga0466718_086242 | 3300042617 | Bacteria | 67871 |
| 227 | Ga0466723_037688 | 3300042618 | Bacteria | 12902 |
| 228 | Ga0466723_051583 | 3300042618 | Bacteria | 2174 |
| 229 | Ga0466723_097148 | 3300042618 | Bacteria | 9515 |
| 230 | Ga0466723_101690 | 3300042618 | Bacteria | 10611 |
| 231 | Ga0466728_052150 | 3300042620 | Bacteria | 14784 |
| 232 | Ga0466701_061693 | 3300042598 | Bacteria | 2637 |
| 233 | Ga0466706_021176 | 3300042599 | Bacteria | 46735 |
| 234 | Ga0466716_057864 | 3300042605 | Bacteria | 6218 |
| 235 | Ga0466716_239764 | 3300042605 | Bacteria | 2009 |
| 236 | Ga0466719_121266 | 3300042606 | Bacteria | 19369 |
| 237 | Ga0466720_007684 | 3300042607 | Bacteria | 4976 |
| 238 | Ga0466720_063741 | 3300042607 | Bacteria | 20121 |
| 239 | Ga0466722_059777 | 3300042609 | Bacteria | 2018 |
| 240 | Ga0466722_168284 | 3300042609 | Bacteria | 10950 |
| 241 | Ga0466732_114342 | 3300042656 | Bacteria | 13888 |
| 242 | Ga0466732_147990 | 3300042656 | Bacteria | 4454 |
| 243 | Ga0466732_291219 | 3300042656 | Bacteria | 9790 |
| 244 | Ga0466729_243189 | 3300042621 | Bacteria | 2133 |
| 245 | Ga0466735_088827 | 3300042624 | Bacteria | 2188 |
| 246 | Ga0466735_211764 | 3300042624 | Unclassified | 1757 |
| 247 | Ga0466703_083109 | 3300042636 | Bacteria | 27128 |
| 248 | Ga0466704_155952 | 3300042643 | Bacteria | 20603 |
| 249 | Ga0466704_325185 | 3300042643 | Bacteria | 25821 |
| 250 | Ga0466709_105394 | 3300042648 | Bacteria | 14214 |
| 251 | Ga0466724_09628 | 3300042649 | Unclassified | 5780 |
| 252 | Ga0466724_39213 | 3300042649 | Bacteria | 121515 |
| 253 | Ga0466725_446871 | 3300042654 | Bacteria | 15771 |
| 254 | Ga0466727_023629 | 3300042655 | Bacteria | 3569 |
| 255 | Ga0466727_211963 | 3300042655 | Bacteria | 5664 |
| 256 | Ga0466727_281529 | 3300042655 | Bacteria | 3478 |
| 257 | Ga0123356_10010875 | 3300010049 | Bacteria | 8897 |
| 258 | Ga0160432_100005 | 3300012818 | Bacteria | 533375 |
| 259 | Ga0160441_100178 | 3300012825 | Bacteria | 68873 |
| 260 | Ga0160472_100655 | 3300012839 | Bacteria | 17547 |
| 261 | Ga0456237_0000100 | 3300041968 | Bacteria | 12328 |
| 262 | Ga0466690_065552 | 3300042590 | Bacteria | 48080 |
| 263 | Ga0466692_054861 | 3300042591 | Bacteria | 3892 |
| 264 | Ga0466691_226483 | 3300042593 | Bacteria | 15893 |
| 265 | Ga0466694_162951 | 3300042594 | Bacteria | 2961 |
| 266 | Ga0466699_338001 | 3300042597 | Bacteria | 21108 |
| 267 | IMNBGM34_c000114 | 3300000036 | Bacteria | 22983 |
| 268 | JGI24698J34947_10007700 | 3300002449 | Unclassified | 5917 |
| 269 | JGI24695J34938_10000069 | 3300002450 | Bacteria | 86031 |
| 270 | JGI24695J34938_10000239 | 3300002450 | Bacteria | 52549 |
| 271 | JGI24695J34938_10002464 | 3300002450 | Bacteria | 14131 |
| 272 | JGI24695J34938_10030939 | 3300002450 | Bacteria | 2488 |
| 273 | CVPL010W_10000522 | 3300002931 | Bacteria | 41203 |
| 274 | Ga0466711_277342 | 3300042615 | Bacteria | 5518 |
| 275 | Ga0466715_530484 | 3300042616 | Bacteria | 14748 |
| 276 | Ga0466718_106602 | 3300042617 | Bacteria | 21056 |
| 277 | Ga0466723_178098 | 3300042618 | Bacteria | 19502 |
| 278 | Ga0466723_202592 | 3300042618 | Bacteria | 5897 |
| 279 | Ga0466723_221705 | 3300042618 | Bacteria | 9345 |
| 280 | Ga0466726_219169 | 3300042619 | Bacteria | 2779 |
| 281 | Ga0466728_052165 | 3300042620 | Bacteria | 25989 |
| 282 | Ga0466707_008927 | 3300042601 | Bacteria | 12187 |
| 283 | Ga0466717_305178 | 3300042604 | Bacteria | 2448 |
| 284 | Ga0466716_046031 | 3300042605 | Bacteria | 11488 |
| 285 | Ga0466716_238956 | 3300042605 | Bacteria | 4871 |
| 286 | Ga0466716_499897 | 3300042605 | Bacteria | 17414 |
| 287 | Ga0466719_081224 | 3300042606 | Bacteria | 28336 |
| 288 | Ga0466720_099902 | 3300042607 | Bacteria | 33350 |
| 289 | Ga0466720_105286 | 3300042607 | Bacteria | 21064 |
| 290 | Ga0466721_160297 | 3300042608 | Bacteria | 1711 |
| 291 | Ga0466722_048250 | 3300042609 | Bacteria | 1973 |
| 292 | Ga0466722_161242 | 3300042609 | Bacteria | 1907 |
| 293 | Ga0466705_050281 | 3300042612 | Bacteria | 6146 |
| 294 | Ga0466705_149057 | 3300042612 | Bacteria | 4093 |
| 295 | Ga0466731_050258 | 3300042622 | Bacteria | 18421 |
| 296 | Ga0466703_070780 | 3300042636 | Bacteria | 5334 |
| 297 | Ga0466704_018563 | 3300042643 | Bacteria | 12561 |
| 298 | Ga0466704_049139 | 3300042643 | Bacteria | 37521 |
| 299 | Ga0466704_428669 | 3300042643 | Bacteria | 7130 |
| 300 | Ga0466709_102347 | 3300042648 | Bacteria | 4415 |
| 301 | Ga0466727_118022 | 3300042655 | Bacteria | 4000 |
| 302 | Ga0466727_297280 | 3300042655 | Bacteria | 14384 |
| 303 | Ga0123356_10001341 | 3300010049 | Bacteria | 27214 |
| 304 | Ga0123356_10006744 | 3300010049 | Bacteria | 11562 |
| 305 | Ga0123353_10149816 | 3300010167 | Bacteria | 3726 |
| 306 | Ga0160453_101245 | 3300012814 | Bacteria | 9715 |
| 307 | Ga0160467_100069 | 3300012829 | Bacteria | 154006 |
| 308 | Ga0160460_100003 | 3300012845 | Bacteria | 802519 |
| 309 | Ga0466690_270167 | 3300042590 | Bacteria | 35972 |
| 310 | Ga0466691_011690 | 3300042593 | Bacteria | 13201 |
| 311 | Ga0466691_176956 | 3300042593 | Bacteria | 7363 |
| 312 | Ga0466696_325062 | 3300042596 | Bacteria | 2938 |
| 313 | Ga0466696_344456 | 3300042596 | Bacteria | 2552 |
| 314 | AustNasuHG_c1000014 | 3300000089 | Bacteria | 40235 |
| 315 | JGI24698J34947_10003796 | 3300002449 | Bacteria | 8232 |
| 316 | JGI24698J34947_10013013 | 3300002449 | Bacteria | 4546 |
| 317 | JGI24698J34947_10014807 | 3300002449 | Bacteria | 4247 |
| 318 | JGI24698J34947_10048805 | 3300002449 | Bacteria | 2142 |
| 319 | JGI24695J34938_10000181 | 3300002450 | Bacteria | 58662 |
| 320 | JGI24695J34938_10000666 | 3300002450 | Bacteria | 32494 |
| 321 | JGI24695J34938_10033730 | 3300002450 | Bacteria | 2353 |
| 322 | JGI24702J35022_10019534 | 3300002462 | Bacteria | 3684 |
| 323 | Ga0072941_1006639 | 3300005201 | Bacteria | 16168 |
| 324 | Ga0466705_394590 | 3300042612 | Bacteria | 3402 |
| 325 | Ga0466712_150260 | 3300042614 | Bacteria | 6404 |
| 326 | Ga0466712_155632 | 3300042614 | Bacteria | 5439 |
| 327 | Ga0466712_310089 | 3300042614 | Bacteria | 8755 |
| 328 | Ga0466712_310176 | 3300042614 | Bacteria | 26726 |
| 329 | Ga0466711_192338 | 3300042615 | Bacteria | 5454 |
| 330 | Ga0466711_253741 | 3300042615 | Bacteria | 3592 |
| 331 | Ga0466718_046001 | 3300042617 | Bacteria | 1632 |
| 332 | Ga0466723_144193 | 3300042618 | Bacteria | 24653 |
| 333 | Ga0466723_216414 | 3300042618 | Bacteria | 14745 |
| 334 | Ga0466723_300421 | 3300042618 | Bacteria | 62170 |
| 335 | Ga0466728_284552 | 3300042620 | Bacteria | 12713 |
| 336 | Ga0466728_451383 | 3300042620 | Bacteria | 2594 |
| 337 | Ga0466728_474327 | 3300042620 | Bacteria | 5286 |
| 338 | Ga0466716_186797 | 3300042605 | Bacteria | 2115 |
| 339 | Ga0466719_037236 | 3300042606 | Bacteria | 13559 |
| 340 | Ga0466720_008341 | 3300042607 | Bacteria | 4468 |
| 341 | Ga0466720_008542 | 3300042607 | Bacteria | 40016 |
| 342 | Ga0466720_040973 | 3300042607 | Bacteria | 6938 |
| 343 | Ga0466720_096239 | 3300042607 | Bacteria | 4381 |
| 344 | Ga0466722_021999 | 3300042609 | Bacteria | 5443 |
| 345 | Ga0466722_173995 | 3300042609 | Bacteria | 4298 |
| 346 | Ga0466722_232195 | 3300042609 | Bacteria | 4025 |
| 347 | Ga0466698_293732 | 3300042610 | Bacteria | 7909 |
| 348 | Ga0466705_015286 | 3300042612 | Bacteria | 2607 |
| 349 | Ga0466705_185603 | 3300042612 | Bacteria | 7938 |
| 350 | Ga0466705_380366 | 3300042612 | Bacteria | 4207 |
| 351 | Ga0466735_182517 | 3300042624 | Bacteria | 5091 |
| 352 | Ga0466703_387789 | 3300042636 | Bacteria | 6650 |
| 353 | Ga0466709_065386 | 3300042648 | Bacteria | 2672 |
| 354 | Ga0466708_067650 | 3300042652 | Bacteria | 28053 |
| 355 | Ga0123356_10007094 | 3300010049 | Bacteria | 11229 |
| 356 | Ga0123353_10010874 | 3300010167 | Bacteria | 12749 |
| 357 | Ga0123353_10044970 | 3300010167 | Bacteria | 7004 |
| 358 | Ga0160471_100001 | 3300012812 | Bacteria | 914646 |
| 359 | Ga0160470_100120 | 3300012813 | Bacteria | 84526 |
| 360 | Ga0160441_100001 | 3300012825 | Bacteria | 1006445 |
| 361 | Ga0160460_100109 | 3300012845 | Bacteria | 109883 |
| 362 | Ga0456237_0000530 | 3300041968 | Bacteria | 5813 |
| 363 | Ga0466690_054274 | 3300042590 | Bacteria | 6380 |
| 364 | Ga0466692_061339 | 3300042591 | Bacteria | 4747 |
| 365 | Ga0466694_079165 | 3300042594 | Bacteria | 40053 |
| 366 | Ga0466696_237547 | 3300042596 | Bacteria | 21193 |
| 367 | AustNasuHG_c1009804 | 3300000089 | Bacteria | 3352 |
| 368 | JGI24698J34947_10007262 | 3300002449 | Bacteria | 6088 |
| 369 | JGI24698J34947_10017779 | 3300002449 | Bacteria | 3850 |
| 370 | JGI24700J35501_10925386 | 3300002508 | Bacteria | 5797 |
| 371 | Ga0072941_1006638 | 3300005201 | Bacteria | 20983 |
| 372 | Ga0072941_1024375 | 3300005201 | Bacteria | 12506 |
| 373 | Ga0466712_074489 | 3300042614 | Bacteria | 14619 |
| 374 | Ga0466712_083267 | 3300042614 | Bacteria | 26241 |
| 375 | Ga0466712_274295 | 3300042614 | Bacteria | 5686 |
| 376 | Ga0466715_047108 | 3300042616 | Bacteria | 9725 |
| 377 | Ga0466715_057348 | 3300042616 | Bacteria | 36717 |
| 378 | Ga0466715_070312 | 3300042616 | Bacteria | 5389 |
| 379 | Ga0466718_033027 | 3300042617 | Bacteria | 9463 |
| 380 | Ga0466723_064342 | 3300042618 | Bacteria | 13672 |
| 381 | Ga0466726_110166 | 3300042619 | Bacteria | 6295 |
| 382 | Ga0466726_145860 | 3300042619 | Bacteria | 1948 |
| 383 | Ga0466726_292913 | 3300042619 | Bacteria | 4707 |
| 384 | Ga0466728_058974 | 3300042620 | Bacteria | 11946 |
| 385 | Ga0466707_194843 | 3300042601 | Bacteria | 1456 |
| 386 | Ga0466716_031006 | 3300042605 | Bacteria | 7630 |
| 387 | Ga0466719_228809 | 3300042606 | Bacteria | 5093 |
| 388 | Ga0466719_524022 | 3300042606 | Bacteria | 2327 |
| 389 | Ga0466720_012731 | 3300042607 | Bacteria | 38091 |
| 390 | Ga0466720_014621 | 3300042607 | Bacteria | 102324 |
| 391 | Ga0466720_101598 | 3300042607 | Bacteria | 3918 |
| 392 | Ga0466720_124792 | 3300042607 | Bacteria | 21794 |
| 393 | Ga0466722_173402 | 3300042609 | Bacteria | 5374 |
| 394 | Ga0466698_466169 | 3300042610 | Bacteria | 3284 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02610 | GO:0008733 | L-arabinose isomerase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.