Protein Family IF05114
Metagenome
Isolate
202
Members
85
Samples
167
Scaffolds
333.62
Avg Length
Representative Sequence
- ID
- 3300042596|Ga0466696_060914|Ga0466696_060914_13249_14472
- Length
- 388 aa
- Sequence
- LYYHYIQKNEKVNTLCRFFLKFLLAAQKFYKGLRLKPIWCMIKGTQGEKNAMIIIIRADAQAEKRAELTDWVRGLGLDVHLSEGADTTVMGLVGDTSRVDIDILKALDIVKDVLRVSEPYKKANRKFHPADSVVGAGGCLAGGGKFALIAGPCSVESEAQIVSVAKKVKAAGAGLLRGGAYKPRSSPYAFQGLKEEGLRLLLLAKKETGLPVVSEITAVTQLPLFGGVDIIQVGARNMQNFELLKELGRTDKPILLKRGLSSTLEELLMSAEYIMAGGNERIILCERGIRTFEPATRNTLDISAVPWLKERTHLPVIVDPSHASGISRLVPPLSLAAAAAGADGLIIEVHEDPARALCDGPQCIKPDELLELVAKLDTVLTLTGKARA
Sample Types
Isolate
17.3%
Metagenome
82.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
30.1%
Termitidae
24.1%
Kalotermitidae
13.3%
Blattidae
13.3%
Tenebrionidae
6.0%
Rhinotermitidae
3.6%
Termopsidae
3.6%
Passalidae
2.4%
Stratiomyidae
1.2%
Hodotermitidae
1.2%
Noctuidae
1.2%
Taxonomy
Archaea
0
Bacteria
187
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820215626 | Unclassified Kiritimatiellaeota Nt197P3bin123 | Isolate | Unclassified |
| 2 | 2820321184 | Unclassified Firmicutes Nt197P3bin86 | Isolate | Unclassified |
| 3 | 2820644600 | Unclassified Firmicutes Cu122P5bin39 | Isolate | Unclassified |
| 4 | 8030343600 | Proteiniborus sp. MB09-C3 | Isolate | Stratiomyidae |
| 5 | 8064531044 | Terrisporobacter mayombei DSM 6539 | Isolate | Unclassified |
| 6 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 7 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 8 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 9 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 10 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 11 | 2940343849 | Breznakia sp. PH5-24 | Isolate | Blattidae |
| 12 | 2940352027 | Breznakia sp. PH1-1 | Isolate | Blattidae |
| 13 | 2820214248 | Unclassified Kiritimatiellaeota Nt197P3bin16 | Isolate | Unclassified |
| 14 | 2820551407 | Unclassified Firmicutes Emb289P4bin38 | Isolate | Unclassified |
| 15 | 2820584674 | Unclassified Firmicutes Emb289P1bin98 | Isolate | Unclassified |
| 16 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 17 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 18 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 19 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 20 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 21 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 22 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 23 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 24 | 2940368928 | Breznakia sp. PFB2-30 | Isolate | Blattidae |
| 25 | 2820001644 | Unclassified Synergistetes Th196P3bin106 | Isolate | Unclassified |
| 26 | 2820705605 | Unclassified Firmicutes Co191P1bin34 | Isolate | Unclassified |
| 27 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 28 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 29 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 30 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 31 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 32 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 33 | 2940354458 | Breznakia sp. PF1-11 | Isolate | Blattidae |
| 34 | 2788499854 | Breznakia blatticola DSM 28867 | Isolate | Unclassified |
| 35 | 2820414148 | Unclassified Firmicutes Lab288P3bin93 | Isolate | Unclassified |
| 36 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 37 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 38 | 2940341480 | Breznakia sp. PFB2-8 | Isolate | Blattidae |
| 39 | 2940356891 | Breznakia sp. PFB1-11 | Isolate | Blattidae |
| 40 | 2940364193 | Breznakia sp. PFB1-19 | Isolate | Blattidae |
| 41 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 42 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 43 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 44 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 45 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 46 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 47 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 48 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 49 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 50 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 51 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 52 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 53 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 54 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 55 | 2940339133 | Breznakia sp. PF5-3 | Isolate | Blattidae |
| 56 | 2940361758 | Breznakia sp. PFB1-14 | Isolate | Blattidae |
| 57 | 2820806175 | Unclassified Actinobacteria Th196P3bin122 | Isolate | Unclassified |
| 58 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 59 | 2820257794 | Unclassified Firmicutes Th196P3bin47 | Isolate | Unclassified |
| 60 | 2820327087 | Unclassified Firmicutes Nt197P3bin79 | Isolate | Unclassified |
| 61 | 2820344559 | Unclassified Firmicutes Nt197P3bin63 | Isolate | Unclassified |
| 62 | 2820362221 | Unclassified Firmicutes Nt197P3bin116 | Isolate | Unclassified |
| 63 | 2820424542 | Unclassified Firmicutes Lab288P3bin47 | Isolate | Unclassified |
| 64 | 2820463629 | Unclassified Firmicutes Lab288P3bin124 | Isolate | Unclassified |
| 65 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 66 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 67 | 2820240463 | Unclassified Firmicutes Th196P3bin85 | Isolate | Unclassified |
| 68 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 69 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 70 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 71 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 72 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 73 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 74 | 2940359323 | Breznakia sp. PFB1-12 | Isolate | Blattidae |
| 75 | 2940366561 | Breznakia sp. PFB1-4 | Isolate | Blattidae |
| 76 | 2820408893 | Unclassified Firmicutes Lab288P4bin80 | Isolate | Unclassified |
| 77 | 2820474468 | Unclassified Firmicutes Lab288P1bin84 | Isolate | Unclassified |
| 78 | 2820556368 | Unclassified Firmicutes Emb289P3bin92 | Isolate | Unclassified |
| 79 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 80 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 81 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 82 | 3300003097 | Cutworm gut microbial communities from Hangzhou, China | Metagenome | Noctuidae |
| 83 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 84 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 85 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10002602 | 3300010049 | Unclassified | 19237 |
| 2 | Ga0123353_10021093 | 3300010167 | Bacteria | 9765 |
| 3 | Ga0123353_10144064 | 3300010167 | Bacteria | 3812 |
| 4 | Ga0123353_10513983 | 3300010167 | Bacteria | 1740 |
| 5 | Ga0123354_10160272 | 3300010882 | Unclassified | 2675 |
| 6 | Ga0466715_225483 | 3300042616 | Bacteria | 17023 |
| 7 | Ga0466715_624800 | 3300042616 | Bacteria | 33953 |
| 8 | Ga0466707_374461 | 3300042601 | Bacteria | 10848 |
| 9 | Ga0466714_105110 | 3300042603 | Bacteria | 1381 |
| 10 | Ga0466717_250982 | 3300042604 | Unclassified | 2464 |
| 11 | Ga0466717_265074 | 3300042604 | Bacteria | 2398 |
| 12 | Ga0466719_373532 | 3300042606 | Bacteria | 11756 |
| 13 | Ga0466720_061149 | 3300042607 | Bacteria | 7557 |
| 14 | Ga0466696_080984 | 3300042596 | Bacteria | 13392 |
| 15 | JGI24705J35276_12231648 | 3300002504 | Bacteria | 4012 |
| 16 | Ga0123357_10000264 | 3300009784 | Bacteria | 49951 |
| 17 | Ga0562374_1347 | 3300057007 | Bacteria | 29423 |
| 18 | Ga0123353_10673327 | 3300010167 | Bacteria | 1459 |
| 19 | Ga0123354_10110834 | 3300010882 | Unclassified | 3626 |
| 20 | Ga0466705_427131 | 3300042612 | Bacteria | 2043 |
| 21 | Ga0466712_015354 | 3300042614 | Bacteria | 1943 |
| 22 | Ga0466712_080808 | 3300042614 | Bacteria | 5457 |
| 23 | Ga0466718_144714 | 3300042617 | Unclassified | 2649 |
| 24 | Ga0466723_076878 | 3300042618 | Bacteria | 14819 |
| 25 | Ga0466707_223112 | 3300042601 | Bacteria | 32347 |
| 26 | Ga0466707_281171 | 3300042601 | Bacteria | 10196 |
| 27 | Ga0466707_309619 | 3300042601 | Bacteria | 29306 |
| 28 | Ga0466707_394137 | 3300042601 | Bacteria | 2055 |
| 29 | Ga0466713_050765 | 3300042602 | Bacteria | 24456 |
| 30 | Ga0466713_130908 | 3300042602 | Bacteria | 7217 |
| 31 | Ga0466714_018525 | 3300042603 | Bacteria | 8125 |
| 32 | Ga0466720_107471 | 3300042607 | Bacteria | 39899 |
| 33 | Ga0466703_196358 | 3300042636 | Bacteria | 12049 |
| 34 | Ga0466704_067637 | 3300042643 | Bacteria | 7442 |
| 35 | Ga0466704_281473 | 3300042643 | Unclassified | 11623 |
| 36 | Ga0466692_082793 | 3300042591 | Bacteria | 2554 |
| 37 | 2227541293 | 2225789004 | Bacteria | 15690 |
| 38 | IMNBL1DRAFT_c0001870 | 3300000062 | Bacteria | 15329 |
| 39 | JGI24698J34947_10000045 | 3300002449 | Bacteria | 35900 |
| 40 | Ga0068305_10139794 | 3300005083 | Bacteria | 7491 |
| 41 | Ga0466705_276137 | 3300042612 | Bacteria | 2219 |
| 42 | Ga0466705_315599 | 3300042612 | Bacteria | 222244 |
| 43 | Ga0562375_0096 | 3300056856 | Bacteria | 273717 |
| 44 | Ga0562376_0690 | 3300056857 | Bacteria | 56078 |
| 45 | Ga0123357_10124949 | 3300009784 | Bacteria | 3226 |
| 46 | Ga0123353_10198279 | 3300010167 | Bacteria | 3162 |
| 47 | Ga0123353_10524549 | 3300010167 | Bacteria | 1717 |
| 48 | Ga0466712_250175 | 3300042614 | Bacteria | 21394 |
| 49 | Ga0466726_350007 | 3300042619 | Bacteria | 45709 |
| 50 | Ga0466707_320159 | 3300042601 | Bacteria | 17010 |
| 51 | Ga0466731_042850 | 3300042622 | Bacteria | 1104 |
| 52 | Ga0466703_371831 | 3300042636 | Bacteria | 42267 |
| 53 | Ga0466703_389791 | 3300042636 | Bacteria | 2498 |
| 54 | Ga0466704_208138 | 3300042643 | Unclassified | 4434 |
| 55 | Ga0415639_027095 | 3300038395 | Bacteria | 13479 |
| 56 | IMNBL1DRAFT_c0027893 | 3300000062 | Bacteria | 2116 |
| 57 | AustNasuHG_c1021528 | 3300000089 | Bacteria | 2085 |
| 58 | JGI24702J35022_10003503 | 3300002462 | Bacteria | 9456 |
| 59 | JGI24702J35022_10069034 | 3300002462 | Bacteria | 1900 |
| 60 | Ga0466697_100922 | 3300042611 | Bacteria | 9669 |
| 61 | Ga0466732_062922 | 3300042656 | Bacteria | 10071 |
| 62 | Ga0123356_10008660 | 3300010049 | Bacteria | 10095 |
| 63 | Ga0123356_10277929 | 3300010049 | Bacteria | 1768 |
| 64 | Ga0123356_10389421 | 3300010049 | Unclassified | 1528 |
| 65 | Ga0123353_10000033 | 3300010167 | Bacteria | 150421 |
| 66 | Ga0123353_11040759 | 3300010167 | Bacteria | 1095 |
| 67 | Ga0466712_109001 | 3300042614 | Bacteria | 1762 |
| 68 | Ga0466712_270219 | 3300042614 | Bacteria | 2498 |
| 69 | Ga0466715_146797 | 3300042616 | Bacteria | 104288 |
| 70 | Ga0466723_256839 | 3300042618 | Bacteria | 5583 |
| 71 | Ga0466726_137958 | 3300042619 | Bacteria | 8871 |
| 72 | Ga0466726_460934 | 3300042619 | Unclassified | 1880 |
| 73 | Ga0466706_152882 | 3300042599 | Bacteria | 22861 |
| 74 | Ga0466707_005520 | 3300042601 | Bacteria | 8481 |
| 75 | Ga0466707_180128 | 3300042601 | Bacteria | 26116 |
| 76 | Ga0466713_130478 | 3300042602 | Bacteria | 4098 |
| 77 | Ga0466720_173608 | 3300042607 | Bacteria | 13917 |
| 78 | Ga0466720_230109 | 3300042607 | Bacteria | 6285 |
| 79 | Ga0466722_025859 | 3300042609 | Bacteria | 11099 |
| 80 | Ga0466731_188324 | 3300042622 | Bacteria | 1742 |
| 81 | Ga0466735_101126 | 3300042624 | Bacteria | 5313 |
| 82 | Ga0466727_236828 | 3300042655 | Bacteria | 1311 |
| 83 | Ga0415639_057658 | 3300038395 | Bacteria | 5933 |
| 84 | Ga0466696_060914 | 3300042596 | Bacteria | 15728 |
| 85 | Ga0466705_209281 | 3300042612 | Bacteria | 7137 |
| 86 | Ga0123355_10245524 | 3300009826 | Bacteria | 2529 |
| 87 | Ga0123355_10456648 | 3300009826 | Bacteria | 1606 |
| 88 | Ga0466712_265690 | 3300042614 | Bacteria | 51797 |
| 89 | Ga0466726_092129 | 3300042619 | Bacteria | 6416 |
| 90 | Ga0466729_046649 | 3300042621 | Bacteria | 10724 |
| 91 | Ga0466707_199429 | 3300042601 | Bacteria | 4405 |
| 92 | Ga0466719_256161 | 3300042606 | Bacteria | 4307 |
| 93 | Ga0466720_128458 | 3300042607 | Bacteria | 29477 |
| 94 | Ga0466735_000957 | 3300042624 | Bacteria | 2342 |
| 95 | Ga0466702_063550 | 3300042635 | Bacteria | 1793 |
| 96 | Ga0466704_245826 | 3300042643 | Bacteria | 1298 |
| 97 | Ga0415639_120608 | 3300038395 | Bacteria | 3757 |
| 98 | Ga0466690_098387 | 3300042590 | Bacteria | 130488 |
| 99 | Ga0466697_164964 | 3300042611 | Bacteria | 3492 |
| 100 | Ga0530661_001284 | 3300056564 | Bacteria | 13295 |
| 101 | Ga0123356_10173332 | 3300010049 | Bacteria | 2171 |
| 102 | Ga0466712_084525 | 3300042614 | Unclassified | 1489 |
| 103 | Ga0466715_311545 | 3300042616 | Bacteria | 4455 |
| 104 | Ga0466718_094685 | 3300042617 | Bacteria | 21732 |
| 105 | Ga0466726_008165 | 3300042619 | Bacteria | 1616 |
| 106 | Ga0466706_000360 | 3300042599 | Bacteria | 2078 |
| 107 | Ga0466706_065220 | 3300042599 | Bacteria | 13272 |
| 108 | Ga0466716_331279 | 3300042605 | Bacteria | 5037 |
| 109 | Ga0466719_080624 | 3300042606 | Bacteria | 5613 |
| 110 | Ga0466719_393226 | 3300042606 | Unclassified | 2043 |
| 111 | Ga0466720_002785 | 3300042607 | Bacteria | 44479 |
| 112 | Ga0466720_045187 | 3300042607 | Bacteria | 27687 |
| 113 | Ga0466720_074145 | 3300042607 | Bacteria | 15093 |
| 114 | Ga0466720_183549 | 3300042607 | Bacteria | 21136 |
| 115 | Ga0466720_221435 | 3300042607 | Bacteria | 1847 |
| 116 | Ga0466729_291345 | 3300042621 | Bacteria | 2157 |
| 117 | Ga0415639_278220 | 3300038395 | Unclassified | 2373 |
| 118 | Ga0466690_377553 | 3300042590 | Bacteria | 42248 |
| 119 | Ga0072941_1110065 | 3300005201 | Bacteria | 7893 |
| 120 | Ga0074263_100693 | 3300005485 | Unclassified | 1506 |
| 121 | Ga0562379_0078 | 3300056790 | Bacteria | 360595 |
| 122 | Ga0562379_3294 | 3300056790 | Unclassified | 11029 |
| 123 | Ga0562375_0013 | 3300056856 | Bacteria | 1229523 |
| 124 | Ga0123355_10003806 | 3300009826 | Bacteria | 21816 |
| 125 | Ga0123355_10011819 | 3300009826 | Bacteria | 13488 |
| 126 | Ga0123355_10266778 | 3300009826 | Bacteria | 2386 |
| 127 | Ga0123353_10135344 | 3300010167 | Bacteria | 3952 |
| 128 | Ga0466718_098872 | 3300042617 | Bacteria | 4026 |
| 129 | Ga0466723_212674 | 3300042618 | Bacteria | 7734 |
| 130 | Ga0466726_490568 | 3300042619 | Bacteria | 9273 |
| 131 | Ga0466707_036264 | 3300042601 | Bacteria | 39071 |
| 132 | Ga0466707_123549 | 3300042601 | Bacteria | 35504 |
| 133 | Ga0466713_013713 | 3300042602 | Bacteria | 305540 |
| 134 | Ga0466719_048415 | 3300042606 | Bacteria | 7389 |
| 135 | Ga0466720_140585 | 3300042607 | Bacteria | 5497 |
| 136 | Ga0466704_114770 | 3300042643 | Bacteria | 11421 |
| 137 | Ga0466727_086783 | 3300042655 | Bacteria | 1739 |
| 138 | Ga0466727_136574 | 3300042655 | Bacteria | 2416 |
| 139 | Ga0264413_135114 | 3300024493 | Bacteria | 31922 |
| 140 | Ga0264413_154967 | 3300024493 | Bacteria | 1745 |
| 141 | JGI24698J34947_10002653 | 3300002449 | Bacteria | 9640 |
| 142 | Ga0466705_249874 | 3300042612 | Bacteria | 13419 |
| 143 | Ga0466732_392923 | 3300042656 | Bacteria | 1430 |
| 144 | Ga0562379_1319 | 3300056790 | Bacteria | 29488 |
| 145 | Ga0562375_0035 | 3300056856 | Bacteria | 623265 |
| 146 | Ga0123355_10008261 | 3300009826 | Bacteria | 15724 |
| 147 | Ga0123355_10015839 | 3300009826 | Bacteria | 11861 |
| 148 | Ga0123353_10000266 | 3300010167 | Bacteria | 65359 |
| 149 | Ga0123353_10105276 | 3300010167 | Bacteria | 4546 |
| 150 | Ga0123354_10248944 | 3300010882 | Bacteria | 1806 |
| 151 | Ga0466705_438455 | 3300042612 | Bacteria | 37690 |
| 152 | Ga0466712_095908 | 3300042614 | Bacteria | 1442 |
| 153 | Ga0466715_102282 | 3300042616 | Bacteria | 28351 |
| 154 | Ga0466718_032367 | 3300042617 | Bacteria | 6323 |
| 155 | Ga0466726_054016 | 3300042619 | Bacteria | 2342 |
| 156 | Ga0466728_004110 | 3300042620 | Bacteria | 23429 |
| 157 | Ga0466728_012820 | 3300042620 | Bacteria | 3274 |
| 158 | Ga0466707_031147 | 3300042601 | Bacteria | 11612 |
| 159 | Ga0466707_076846 | 3300042601 | Bacteria | 1473 |
| 160 | Ga0466707_326586 | 3300042601 | Bacteria | 5495 |
| 161 | Ga0466714_018036 | 3300042603 | Bacteria | 1465 |
| 162 | Ga0466714_096818 | 3300042603 | Bacteria | 5713 |
| 163 | Ga0466729_284652 | 3300042621 | Bacteria | 1903 |
| 164 | Ga0466708_038123 | 3300042652 | Bacteria | 39880 |
| 165 | Ga0466696_226681 | 3300042596 | Bacteria | 10889 |
| 166 | JGI24702J35022_10002602 | 3300002462 | Bacteria | 10962 |
| 167 | Ga0052191_101586 | 3300003097 | Unclassified | 1100 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00793 | GO:0009058 | biosynthetic process | BP |
| PF03102 | GO:0016051 | carbohydrate biosynthetic process | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.