Protein Family IF05109

Metagenome Isolate
296 Members
253 Samples
92 Scaffolds
545.64 Avg Length

🧬 Representative Sequence

ID
3300042596|Ga0466696_055382|Ga0466696_055382_7490_9292
Length
581 aa
Sequence
MVVLVLADLMFRRNIAHQTLQLFILDSIHFIYFLKLMSIHELAGQPAPKSILVNVNDLEKNYYEQKPDPENPTQLVVFGTSGHRGTSLDGSFTESHILAIAQAVCDYRSQQGYTGKLYLGKDTHFLSGPAQKTALEVFAANNVEVVFQADDGFTPTPVISWAILQHNKPNTLKGNENSLADGVIITPSHNPPSDGGIKYNCPNGGPADTDVTGWIQTQANHYLKSNLKGIQRIAYEKSVALPHIQTIDFSEDYIADLENIVDLQAIAERKIRIGVDPLGGAGNAYWQPIAERYRLDLTVVNQAIDPTFSFMSVDHDGKIRMDCSSPYAMRGLVALKDQFDIAFANDPDTDRHGIVVPSVGLMNPNHYLAVAIQYLFTHRPNWAKGIGVGKTLVSSGIIDRVVSDLRLQLVEVPVGFKWFVDGLYNSNIGFGGEESAGASFLRKNGQVWSTDKDGIILNLLAAEILAKTQLDPGQIYREIEQRFGQSFYTRIDQATTPEQKSAFKKLTPDKVLAPITAKLTTASGNGASIGGLKVVSTEGWFAARPSGTENIYKIYAESFKSKEHLNNIVAEAKKIVDAALC

πŸ“Š Sample Types

Isolate 68.9%
Metagenome 31.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 30.6%
Drosophilidae 9.5%
Anthocoridae 8.7%
Muscidae 5.4%
Termitidae 5.0%
Kalotermitidae 4.5%
Tenebrionidae 4.1%
Curculionidae 4.1%
Calliphoridae 3.7%
Culicidae 2.9%
Tephritidae 2.1%
Cerambycidae 1.7%
Armadillidiidae 1.2%
Apidae 1.2%
Aphididae 1.2%
Pteromalidae 1.2%
Rhinotermitidae 0.8%
Sarcophagidae 0.8%
Termopsidae 0.8%
Pentatomidae 0.8%
Formicidae 0.8%
Majidae 0.8%
Reduviidae 0.8%
Thripidae 0.4%
Anthomyiidae 0.4%
Dytiscidae 0.4%
Passalidae 0.4%
Crambidae 0.4%
Aphalaridae 0.4%
Daphniidae 0.4%
Ixodidae 0.4%
Scarabaeidae 0.4%
Ceratophyllidae 0.4%
Aleyrodidae 0.4%
Talitridae 0.4%
Cicadellidae 0.4%
Plutellidae 0.4%
Rhopalidae 0.4%
Glossinidae 0.4%
Carabidae 0.4%

🌳 Taxonomy

Archaea 0
Bacteria 280
Eukaryota 0
Viruses 0
Unclassified 16

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2860776474 Vibrio parahaemolyticus R14 Isolate Unclassified
2 2871760914 Pantoea ananatis PANS 01-2 Isolate Thripidae
3 2921816052 Cronobacter sakazakii MOD1-Anth48g Isolate Anthomyiidae
4 2922113941 Serratia sp. OLEL1 Isolate Anthocoridae
5 2937427229 Cronobacter malonaticus MOD1-Md99g Isolate Muscidae
6 2937751072 Serratia sp. OLMTLW26 Isolate Anthocoridae
7 2958255616 Serratia marcescens TM Isolate
8 2965197371 Serratia sp. OLCL1 Isolate Anthocoridae
9 2507262057 Enterobacteriaceae bacterium FGI 57 Isolate Unclassified
10 2551306516 Enterobacter hormaechei YT3 Isolate Tenebrionidae
11 2599185261 Thorsellia anophelis DSM 18579 Isolate Unclassified
12 2627854002 Vibrio nigripulchritudo ENn2 Isolate Unclassified
13 2675903013 Rhodococcus triatomae DSM 44892 Isolate Unclassified
14 3001459110 Tatumella sp. JGM118 Isolate Drosophilidae
15 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
16 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
17 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
18 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
19 651324086 Plautia crossota stali symbiont Isolate Unclassified
20 8001059720 Tenebrionicola larvae YMB-R22 Isolate Tenebrionidae
21 8022087107 Vibrio sp. OULL4 Isolate Unclassified
22 8062647588 Nissabacter archeti JGM97 Isolate Drosophilidae
23 8071333649 Escherichia coli PN108 Isolate Calliphoridae
24 8071338694 Escherichia coli PN87 Isolate Calliphoridae
25 8102982778 Erwinia sp. S63 Isolate Curculionidae
26 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
27 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
28 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
29 2833053935 Buttiauxella sp. 3AFRM03 Isolate Cerambycidae
30 2837516909 Rahnella bruchi DSM 27398 Isolate Unclassified
31 2841260384 Providencia alcalifaciens Dmel2 Isolate Drosophilidae
32 2854520951 Acetobacter pasteurianus AD Isolate Unclassified
33 2873614151 Leucobacter viscericola HDW9C Isolate Dytiscidae
34 2878947168 Serratia marcescens ADJS-2D_White Isolate Unclassified
35 2885043073 Erwinia sp. OLSSP12 Isolate Anthocoridae
36 2896187957 Providencia stuartii Crippen Isolate Calliphoridae
37 2902438364 Photobacterium damselae Hep-2a-11 Isolate Unclassified
38 2937735258 Serratia marcescens KZ11 Isolate Apidae
39 2961247850 Serratia sp. OLAL2 Isolate Anthocoridae
40 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
41 2551306531 Enterobacter hormaechei YT2 Isolate Tenebrionidae
42 2648501820 Vibrio nigripulchritudo BLFn1 Isolate Unclassified
43 2667527830 Vibrio parahaemolyticus ISF-29-3 Isolate Unclassified
44 2700989396 Vibrio parahaemolyticus ISF-77-01 Isolate Unclassified
45 2731957969 Proteus mirabilis Wood Isolate Calliphoridae
46 2744054871 Candidatus Arsenophonus triatominarum ATi Isolate Unclassified
47 2756170277 Enterobacillus tribolii DSM 103736 Isolate Unclassified
48 2785510762 Vibrio parahaemolyticus VP14 Isolate Unclassified
49 2786546124 Acetobacter sp. JWB Isolate Drosophilidae
50 2820178484 Unclassified Planctomycetes Th196P3bin110 Isolate Unclassified
51 2970335472 Cronobacter muytjensii MOD1-Md1s Isolate Muscidae
52 2977727922 Cronobacter sakazakii MOD1-Md33s Isolate Muscidae
53 2978102237 Serratia fonticola AeS1 Isolate Culicidae
54 3007994558 Escherichia alba B35 Isolate Tenebrionidae
55 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
56 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
57 8004307473 Serratia sp. OLIL2 Isolate Anthocoridae
58 8004571736 Serratia sp. OLDL1 Isolate Anthocoridae
59 8021535516 Klebsiella sp. Kd70 TUC-EEAOC Isolate Crambidae
60 8100181737 Kosakonia sp. S58 Isolate Curculionidae
61 2858407585 Photobacterium swingsii DSM 24669 Isolate Unclassified
62 2874434233 Serratia marcescens ADJS-2C_Red Isolate Unclassified
63 2880115952 Vibrio parahaemolyticus PB1937 Isolate Unclassified
64 2912636047 Vibrio crassostreae 9CS106 Isolate Unclassified
65 2961232173 Serratia sp. OLLOLW30 Isolate Anthocoridae
66 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
67 2509601000 Secondary endosymbiont of Ctenarytaina eucalypti Thao2000 Isolate Aphalaridae
68 2531839602 Shimwellia blattae NBRC 105725 Isolate Unclassified
69 2574179716 Serratia sp. DD3 Isolate Daphniidae
70 2597489903 Providencia sneebia DSM 19967 Isolate Drosophilidae
71 2609459958 Vibrio nigripulchritudo Wn13 Isolate Unclassified
72 2630968716 Vibrio nigripulchritudo AM115 Isolate Unclassified
73 2636415542 Vibrio nigripulchritudo SFn135 Isolate Unclassified
74 2718217944 Serratia marcescens AS1 Isolate Culicidae
75 2765235945 Kosakonia cowanii Esp_Z Isolate Culicidae
76 2820205024 Unclassified Planctomycetes Cu122P4bin3 Isolate Unclassified
77 2970791725 Serratia sp. OLBL1 Isolate Anthocoridae
78 2977691992 Cronobacter malonaticus MOD1-Md27g Isolate Muscidae
79 2977745872 Cronobacter sakazakii MOD1-Md1g Isolate Muscidae
80 2996467878 Serratia sp. OLFL2 Isolate Anthocoridae
81 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
82 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
83 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
84 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
85 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
86 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
87 8048928574 Photobacterium swingsii CECT 7576 Isolate Unclassified
88 8100176769 Kosakonia sp. S57 Isolate Curculionidae
89 8109397740 Rhodococcus triatomae DSM 44892 Isolate Unclassified
90 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
91 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
92 2843864159 Acetobacter pomorum SH Isolate Drosophilidae
93 2862075925 Corynebacterium lactis S064 Isolate Ixodidae
94 2871771314 Pantoea sp. Ae16 Isolate Culicidae
95 2885046828 Erwinia sp. OLCASP19 Isolate Anthocoridae
96 2885054481 Erwinia sp. OLMDSP33 Isolate Anthocoridae
97 2921842437 Cronobacter sakazakii MOD1-Lc10s Isolate Calliphoridae
98 2957730672 Cronobacter sakazakii MOD1-Md70g Isolate Muscidae
99 2524614872 Arsenophonus nasoniae DSM 15247 Isolate Unclassified
100 2529292851 Providencia burhodogranariea DSM 19968 Isolate Drosophilidae
101 2565956518 Vibrio pacinii DSM 19139 Isolate Unclassified
102 2600255074 Vibrio proteolyticus NBRC 13287 Isolate Unclassified
103 2645727860 Winslowiella iniecta B120 Isolate Aphididae
104 2651870110 Izhakiella capsodis N6PO6 Isolate Unclassified
105 2693429575 Vibrio parahaemolyticus ISF-54-12 Isolate Unclassified
106 2703719240 Serratia marcescens ano2 Isolate Unclassified
107 2967915117 Cronobacter sakazakii MOD1-Lc10g Isolate Calliphoridae
108 2979682021 Cronobacter turicensis MOD1-Sh41s Isolate Sarcophagidae
109 2997380424 Vibrio parahaemolyticus MVP1 Isolate Unclassified
110 3004010258 Citrobacter sp. JGM124 Isolate Drosophilidae
111 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
112 3300007149 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut Metagenome Drosophilidae
113 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
114 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
115 648276708 Pantoea sp. aB Isolate Unclassified
116 651324000 Acetobacter pomorum DM001 Isolate Drosophilidae
117 8001394582 Limnobaculum allomyrinae BWR-B9 Isolate Scarabaeidae
118 8006199443 Yersinia pestis M-1763 Isolate Ceratophyllidae
119 8022345672 Vibrio sp. 070316B Isolate Unclassified
120 8073124432 Escherichia coli MOD1-EC294 Isolate Unclassified
121 8074292191 Tatumella sp. JGM94 Isolate Drosophilidae
122 8101676404 Providencia sp. JGM172 Isolate Drosophilidae
123 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
124 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
125 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
126 2836714267 Shimwellia blattae NCTC10965 Isolate
127 2836755666 Arsenophonus nasoniae FIN Isolate Pteromalidae
128 2846386538 Rahnella sp. AN3-3W3 Isolate Pentatomidae
129 2876358570 Cronobacter sakazakii MOD1-Ls15g Isolate Calliphoridae
130 2888667245 Corynebacterium diphtheriae FRC0190 Isolate Unclassified
131 2937387794 Cronobacter turicensis MOD1-Sh41g Isolate Sarcophagidae
132 2938192669 Citrobacter sp. TSA-1 Isolate Unclassified
133 2513020017 Shimwellia blattae DSM 4481 Isolate Unclassified
134 2971189173 Yersinia pestis A-1249 Isolate Unclassified
135 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
136 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
137 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
138 8021546568 Klebsiella sp. Kps Isolate Tephritidae
139 8065462725 Tatumella sp. JGM100 Isolate Drosophilidae
140 8065466226 Tatumella sp. JGM130 Isolate Drosophilidae
141 8065469765 Tatumella sp. JGM16 Isolate Drosophilidae
142 8071322446 Escherichia coli PN122 Isolate Calliphoridae
143 8100171289 Kosakonia sp. S42 Isolate Curculionidae
144 8101680043 Providencia sp. JGM178 Isolate Drosophilidae
145 8103002986 Erwinia sp. S38 Isolate Curculionidae
146 8103008710 Erwinia sp. S43 Isolate Curculionidae
147 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
148 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
149 8116627632 Vibrio penaeicida NBRC 15640 Isolate Unclassified
150 2822856742 Enterobacter cancerogenus CR-Eb1 Isolate Unclassified
151 2848317263 Arsenophonus endosymbiont of Aleurodicus floccissimus ARAF Isolate Aleyrodidae
152 2850131454 Providencia rettgeri NVIT03 Isolate Pteromalidae
153 2873884416 Photobacterium sanguinicancri Mj110 CAIM 1827 Isolate Majidae
154 2874880541 Enterobacter hormaechei E3442 Isolate Unclassified
155 2898975184 Erwinia dacicola IL Isolate Tephritidae
156 2964846109 Cronobacter sakazakii MOD1-Md5g Isolate Muscidae
157 2964859436 Cronobacter sakazakii MOD1-Md40g Isolate Muscidae
158 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
159 2518285522 Photorhabdus khanii NC19 Isolate Unclassified
160 2547132185 Enterobacter cancerogenus YZ1 Isolate Tenebrionidae
161 2551306507 Vibrio parahaemolyticus PCV08-7 Isolate Unclassified
162 2617271320 Acetobacter pomorum DmCS_004 Isolate Drosophilidae
163 2619619082 Pantoea agglomerans SL1_M5 Isolate Unclassified
164 2636415586 Vibrio harveyi NBRC 15634 Isolate Talitridae
165 2648501856 Candidatus Baumannia cicadellinicola BGSS Isolate Cicadellidae
166 2778261152 Escherichia coli MOD1-EC284 Isolate Unclassified
167 2791355473 Vibrio barjaei 3062 Isolate Unclassified
168 2820201435 Unclassified Planctomycetes Cu122P5bin25 Isolate Unclassified
169 2978161719 Serratia marcescens KZ2 Isolate Apidae
170 3000861951 Budvicia diplopodorum D9 Isolate
171 3004364956 Cronobacter sakazakii MOD1-Md5s Isolate Muscidae
172 3006242587 Vibrio sp. RE86 Isolate Unclassified
173 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
174 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae
175 3300035364 Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut Metagenome Plutellidae
176 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
177 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
178 8018312681 Enterobacter sp. OLF Isolate Tephritidae
179 8021540981 Klebsiella sp. Kpp Isolate Tephritidae
180 8028002147 Enterobacter sp. 10-1 Isolate Cerambycidae
181 8048923410 Photobacterium sanguinicancri CECT 7579 Isolate Unclassified
182 8051534459 Vibrio vulnificus Vv004 Isolate
183 8099192374 Erwinia typographi IC4 Isolate Curculionidae
184 8110023836 Enterobacterales bacterium BIT-L3 Isolate Tenebrionidae
185 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
186 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
187 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
188 2824588292 Yokenella regensburgei WCD67 Isolate Rhopalidae
189 2841175817 Komagataeibacter saccharivorans JH1 Isolate Unclassified
190 2847708326 Serratia liquefaciens P2ACOL2 Isolate Cerambycidae
191 2856068565 Cronobacter sakazakii MOD1-Md35s Isolate Muscidae
192 2874504452 Serratia marcescens ADJS-2C_Purple Isolate Unclassified
193 2875320051 Vibrio parahaemolyticus 160807 Isolate Unclassified
194 2877647439 Vibrio parahaemolyticus R13 Isolate Unclassified
195 2885058212 Erwinia sp. OLTSP20 Isolate Anthocoridae
196 2896925746 Vibrio nigripulchritudo SFn27 Isolate Unclassified
197 2901296437 Erwinia dacicola Oroville Isolate Tephritidae
198 2820876581 Unclassified Actinobacteria Lab288P1bin83 Isolate Unclassified
199 2510065003 Arsenophonus triatominarum ArT Isolate Reduviidae
200 2588253732 Klebsiella pneumoniae pneumoniae KP5-1 Isolate Pentatomidae
201 2609459925 Vibrio nigripulchritudo SO65 Isolate Unclassified
202 2627853677 Vibrio nigripulchritudo FTn2 Isolate Unclassified
203 2820185449 Unclassified Planctomycetes Lab288P3bin146 Isolate Unclassified
204 2967924226 Cronobacter malonaticus MOD1-Md25g Isolate Muscidae
205 2970322301 Cronobacter sakazakii MOD1-Md33g Isolate Muscidae
206 2989793055 Vibrio atypicus DSM 25292 Isolate Unclassified
207 2996406003 Serratia sp. OLJL1 Isolate Anthocoridae
208 3001462594 Tatumella sp. JGM91 Isolate Drosophilidae
209 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
210 637000270 Sodalis glossinidius morsitans Isolate Glossinidae
211 8004118532 Citrobacter amalonaticus ku-bf3 Isolate Carabidae
212 8022096067 Vibrio sp. SALL6 Isolate Unclassified
213 8022116796 Vibrio sp. T3Y01 Isolate Unclassified
214 8051461712 Vibrio vulnificus Vv002 Isolate
215 8060845732 Vibrio vulnificus Vv006 Isolate
216 8071343737 Escherichia coli PN119 Isolate Calliphoridae
217 8074288691 Tatumella sp. JGM82 Isolate Drosophilidae
218 8076047169 Erwinia haradaeae ErCipseudotsugae/2889 Isolate Aphididae
219 8101683685 Providencia sp. JGM181 Isolate Drosophilidae
220 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
221 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
222 2835335304 Rahnella sp. Larv3_ips Isolate Curculionidae
223 2859315706 Serratia sp. 3ACOL1 Isolate Cerambycidae
224 2876334352 Cronobacter sakazakii MOD1-Md6g Isolate Muscidae
225 2885050628 Erwinia sp. OLMTSP26 Isolate Anthocoridae
226 2885061987 Erwinia sp. OLFS4 Isolate Anthocoridae
227 2885065815 Erwinia sp. OAMSP11 Isolate Anthocoridae
228 2898991528 Erwinia sp. OLMDLW33 Isolate Anthocoridae
229 2912570088 Vibrio parahaemolyticus CHN25 Isolate
230 2961206375 Serratia sp. OMLW3 Isolate Anthocoridae
231 2510065002 Arsenophonus sp. ArN Isolate Pteromalidae
232 2519899623 Enterobacter sp. Ag1 Isolate Culicidae
233 2528768159 Alteromonadaceae bacterium Bs31 Isolate Unclassified
234 2537561600 Salmonella enterica enterica sv. Newport CVM 19443 Isolate Unclassified
235 2545824723 Rhodococcus rhodnii LMG 5362 Isolate Reduviidae
236 2551306520 Aliivibrio logei ATCC 35077 Isolate Majidae
237 2554235022 Vibrio parahaemolyticus v110 Isolate
238 2588253791 Yokenella regensburgei F. Haas DC-1, ATCC 49455 Isolate Unclassified
239 2648501209 Winslowiella iniecta B149 Isolate Aphididae
240 2663763317 Vibrio parahaemolyticus ISF-94-1 Isolate Unclassified
241 2703719239 Serratia marcescens ano1 Isolate Unclassified
242 2778261153 Escherichia coli MOD1-EC286 Isolate Unclassified
243 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
244 3300005318 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut Metagenome Drosophilidae
245 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
246 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
247 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
248 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
249 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
250 8004285568 Serratia sp. OLHL2 Isolate Anthocoridae
251 8004541719 Serratia marcescens KZ19 Isolate Apidae
252 8004582426 Serratia sp. OSPLW9 Isolate Anthocoridae
253 8051551332 Vibrio vulnificus Vv003 Isolate

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123355_10017153 3300009826 Unclassified 11432
2 Ga0123353_10001062 3300010167 Bacteria 33595
3 Ga0123353_10001449 3300010167 Bacteria 28983
4 DPOL_contig14240 2035918003 Bacteria 36210
5 FGTW_contig16704 2065487013 Unclassified 2136
6 CVPL010L_1000121 3300002932 Bacteria 26369
7 Ga0068302_10125394 3300005071 Bacteria 1755
8 Ga0104040_1142440 3300007149 Bacteria 2794
9 Ga0160460_100026 3300012845 Bacteria 329165
10 Ga0466707_165779 3300042601 Bacteria 177707
11 Ga0466713_103029 3300042602 Bacteria 264074
12 Ga0466705_320174 3300042612 Bacteria 2602
13 Ga0466703_233935 3300042636 Bacteria 7697
14 Ga0466724_01259 3300042649 Unclassified 11019
15 Ga0466708_290128 3300042652 Bacteria 5892
16 Ga0562377_0001 3300056842 Bacteria 5082480
17 Ga0123357_10047812 3300009784 Bacteria 5798
18 Ga0123355_10323109 3300009826 Bacteria 2076
19 Ga0123356_10027009 3300010049 Bacteria 5382
20 Ga0466692_069337 3300042591 Bacteria 7142
21 Ga0466693_388551 3300042592 Bacteria 8949
22 Ga0466707_005362 3300042601 Unclassified 1781
23 Ga0466713_089703 3300042602 Bacteria 37167
24 Ga0466716_050991 3300042605 Bacteria 4301
25 Ga0466719_500244 3300042606 Bacteria 9100
26 Ga0466703_076237 3300042636 Bacteria 2027
27 Ga0466703_236983 3300042636 Bacteria 2218
28 Ga0466724_03028 3300042649 Unclassified 2005
29 Ga0562375_0008 3300056856 Bacteria 1786936
30 Ga0123355_10020729 3300009826 Bacteria 10508
31 FGTW_contig32725 2065487013 Unclassified 2250
32 Meta3P_1000048 3300002464 Bacteria 60398
33 Ga0063521_1000099 3300003973 Bacteria 69359
34 Ga0063521_1000181 3300003973 Bacteria 46094
35 Ga0063521_1005616 3300003973 Unclassified 2965
36 Ga0105005_1275156 3300007505 Bacteria 7334
37 Ga0160443_102129 3300012848 Unclassified 4867
38 Ga0562379_0244 3300056790 Unclassified 147538
39 Ga0562377_0183 3300056842 Bacteria 165152
40 Ga0466715_365310 3300042616 Bacteria 3997
41 Ga0466729_014118 3300042621 Bacteria 40283
42 Ga0123355_10112789 3300009826 Bacteria 4242
43 Ga0123355_10230938 3300009826 Bacteria 2642
44 Ga0123354_10002351 3300010882 Bacteria 24824
45 DPOL_contig01160 2035918003 Bacteria 3464
46 CVPL010L_1000330 3300002932 Bacteria 30598
47 Ga0316159_11206 3300030930 Unclassified 3381
48 Ga0466694_307473 3300042594 Bacteria 2092
49 Ga0466729_284089 3300042621 Bacteria 2197
50 Ga0466730_062206 3300042625 Bacteria 48849
51 Ga0466724_09622 3300042649 Bacteria 60623
52 Ga0562379_0001 3300056790 Bacteria 4904077
53 Ga0466711_156461 3300042615 Bacteria 7094
54 Ga0466711_235468 3300042615 Bacteria 4559
55 Ga0466715_435097 3300042616 Bacteria 4257
56 Ga0466723_141908 3300042618 Bacteria 9334
57 Ga0123355_10085175 3300009826 Unclassified 5031
58 Ga0123356_10018466 3300010049 Unclassified 6621
59 Ga0063521_1000179 3300003973 Bacteria 46734
60 Ga0074188_1000224 3300005318 Bacteria 57952
61 Ga0265387_1000014 3300024582 Bacteria 72789
62 Ga0466696_055382 3300042596 Bacteria 12426
63 Ga0466716_133232 3300042605 Bacteria 8500
64 Ga0562374_0108 3300057007 Bacteria 213157
65 FGTW_contig31053 2065487013 Unclassified 6205
66 Ga0160433_100942 3300012846 Bacteria 9651
67 Ga0466691_093492 3300042593 Bacteria 7211
68 Ga0466734_147032 3300042623 Bacteria 3319
69 Ga0466730_000500 3300042625 Bacteria 17017
70 Ga0466708_385492 3300042652 Bacteria 15333
71 Ga0466727_288626 3300042655 Bacteria 4558
72 Ga0466728_036519 3300042620 Bacteria 10002
73 Ga0123355_10024762 3300009826 Bacteria 9650
74 Ga0123356_10052959 3300010049 Unclassified 3777
75 Ga0123356_10196610 3300010049 Bacteria 2053
76 Ga0123353_10128737 3300010167 Bacteria 4065
77 FGTW_contig30607 2065487013 Bacteria 13947
78 Ga0063521_1000573 3300003973 Bacteria 15726
79 Ga0160455_100022 3300012837 Bacteria 376035
80 Ga0247290_00250 3300035364 Bacteria 13934
81 Ga0466730_045935 3300042625 Bacteria 18946
82 Ga0466730_065045 3300042625 Bacteria 39695
83 Ga0466711_117399 3300042615 Bacteria 5626
84 Ga0466715_076300 3300042616 Bacteria 22436
85 Ga0123356_10001734 3300010049 Bacteria 23772
86 FGTW_contig32849 2065487013 Unclassified 1789
87 2227080781 2225789004 Bacteria 168264
88 JGI24702J35022_10013548 3300002462 Bacteria 4514
89 Ga0104041_1001122 3300007106 Unclassified 6700
90 Ga0316159_10177 3300030930 Bacteria 10860
91 Ga0466701_035375 3300042598 Bacteria 4099
92 Ga0466724_17605 3300042649 Bacteria 124775

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02878 PGM_PMM_I Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I 77 221 0.96
PF02880 PGM_PMM_III Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III 363 482 0.96
PF02879 PGM_PMM_II Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II 251 355 0.89
PF00408 PGM_PMM_IV Phosphoglucomutase/phosphomannomutase, C-terminal domain 526 572 0.85

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02879 GO:0005975 carbohydrate metabolic process BP

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.