Protein Family IF05084
Metagenome
Isolate
122
Members
49
Samples
118
Scaffolds
234.11
Avg Length
Representative Sequence
- ID
- 3300042595|Ga0466695_324772|Ga0466695_324772_145_975
- Length
- 276 aa
- Sequence
- MYFCFVKITIDLHCPDCQSEYVTKNGKKSYKKQNYLCKNCGRQFIGDHALSYKGCHSGLTRRILLMLVRGNGIRDVAEIEGISIKKVLSVLTNSKHIIKPKQSYYDTLEVDEFWTYVGEKKNKVWLLYAYHRESGEIVSFVWGKRDLQTAQKLKDKLSDLGVSYGSIATDNWDSFVTVFKGDNHLIGKEYTVGIEGNNCRLRHRIRRAFRKTCCFSKKLFNHFKAFNLAFFYINFGFVCRTPPNLFVLWSKFSLSNANVYTGSNKWYSSALFNCLT
Sample Types
Isolate
3.3%
Metagenome
96.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
68.1%
Kalotermitidae
12.8%
Passalidae
6.4%
Unclassified
4.3%
Termopsidae
4.3%
Elmidae
2.1%
Rhinotermitidae
2.1%
Taxonomy
Archaea
0
Bacteria
92
Eukaryota
0
Viruses
0
Unclassified
30
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3003178663 | Psychrobacter fulvigenes KC-40 | Isolate | Unclassified |
| 2 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 3 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 4 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 5 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 9 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 10 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 11 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 12 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 13 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 14 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 15 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 16 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 17 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 18 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 19 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 20 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 21 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 22 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 23 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 24 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 25 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 26 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 27 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 28 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 29 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 30 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 31 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 32 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 33 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 34 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 35 | 2864804954 | Acinetobacter johnsonii S00050 | Isolate | Elmidae |
| 36 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 37 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 38 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 39 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 40 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 41 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 42 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 43 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 44 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 45 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 46 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 47 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 48 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 49 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_031526 | 3300042659 | Bacteria | 4079 |
| 2 | Ga0466733_190358 | 3300042659 | Unclassified | 1350 |
| 3 | Ga0123356_10609316 | 3300010049 | Unclassified | 1257 |
| 4 | Ga0123356_10872393 | 3300010049 | Unclassified | 1071 |
| 5 | Ga0466656_151982 | 3300042550 | Bacteria | 1157 |
| 6 | Ga0466699_049495 | 3300042597 | Bacteria | 1150 |
| 7 | Ga0466710_103481 | 3300042613 | Bacteria | 1050 |
| 8 | Ga0466702_196853 | 3300042635 | Bacteria | 1048 |
| 9 | Ga0466703_064376 | 3300042636 | Bacteria | 15867 |
| 10 | Ga0466703_148946 | 3300042636 | Bacteria | 1768 |
| 11 | Ga0466704_155527 | 3300042643 | Unclassified | 2640 |
| 12 | 2227042601 | 2225789003 | Unclassified | 842 |
| 13 | JGI24695J34938_10200269 | 3300002450 | Bacteria | 832 |
| 14 | Ga0123355_10554677 | 3300009826 | Bacteria | 1387 |
| 15 | Ga0123356_10110601 | 3300010049 | Bacteria | 2653 |
| 16 | Ga0123356_11794431 | 3300010049 | Unclassified | 762 |
| 17 | Ga0466691_040980 | 3300042593 | Bacteria | 6057 |
| 18 | Ga0466699_263246 | 3300042597 | Bacteria | 1107 |
| 19 | Ga0466718_093775 | 3300042617 | Unclassified | 1216 |
| 20 | IMNBL1DRAFT_c0060576 | 3300000062 | Unclassified | 1140 |
| 21 | Ga0466701_077907 | 3300042598 | Bacteria | 1351 |
| 22 | Ga0466700_101856 | 3300042600 | Bacteria | 1232 |
| 23 | Ga0466717_143136 | 3300042604 | Bacteria | 1120 |
| 24 | Ga0466721_040254 | 3300042608 | Bacteria | 1079 |
| 25 | Ga0466733_119664 | 3300042659 | Unclassified | 1310 |
| 26 | Ga0265387_1005147 | 3300024582 | Bacteria | 1765 |
| 27 | Ga0415639_078746 | 3300038395 | Bacteria | 974 |
| 28 | Ga0466656_001678 | 3300042550 | Bacteria | 1126 |
| 29 | Ga0466695_067693 | 3300042595 | Bacteria | 1193 |
| 30 | Ga0466699_443576 | 3300042597 | Bacteria | 1175 |
| 31 | Ga0466718_125739 | 3300042617 | Unclassified | 1020 |
| 32 | Ga0466734_098270 | 3300042623 | Bacteria | 1055 |
| 33 | Ga0466734_141594 | 3300042623 | Bacteria | 1528 |
| 34 | Ga0466735_154739 | 3300042624 | Bacteria | 1162 |
| 35 | Ga0466703_005424 | 3300042636 | Bacteria | 1257 |
| 36 | IMNBL1DRAFT_c0042688 | 3300000062 | Bacteria | 1509 |
| 37 | IMNBL1DRAFT_c0049324 | 3300000062 | Unclassified | 1343 |
| 38 | IMNBL1DRAFT_c0086355 | 3300000062 | Unclassified | 868 |
| 39 | JGI24702J35022_10356047 | 3300002462 | Unclassified | 876 |
| 40 | Ga0068302_10076422 | 3300005071 | Bacteria | 1012 |
| 41 | Ga0466707_401462 | 3300042601 | Bacteria | 1452 |
| 42 | Ga0466721_177964 | 3300042608 | Bacteria | 1260 |
| 43 | Ga0466697_205519 | 3300042611 | Bacteria | 1528 |
| 44 | Ga0466705_037596 | 3300042612 | Bacteria | 3586 |
| 45 | Ga0466733_118319 | 3300042659 | Bacteria | 1203 |
| 46 | Ga0123357_10426016 | 3300009784 | Bacteria | 1178 |
| 47 | Ga0265387_1002891 | 3300024582 | Bacteria | 2401 |
| 48 | Ga0466694_071711 | 3300042594 | Bacteria | 1208 |
| 49 | Ga0466695_324772 | 3300042595 | Bacteria | 1199 |
| 50 | Ga0466699_160314 | 3300042597 | Bacteria | 1229 |
| 51 | Ga0466723_151866 | 3300042618 | Bacteria | 2955 |
| 52 | Ga0466724_40624 | 3300042649 | Bacteria | 1453 |
| 53 | 2227381921 | 2225789004 | Unclassified | 1098 |
| 54 | 2227486184 | 2225789004 | Unclassified | 817 |
| 55 | Ga0466714_118030 | 3300042603 | Bacteria | 1064 |
| 56 | Ga0466722_014038 | 3300042609 | Bacteria | 4612 |
| 57 | Ga0466722_025279 | 3300042609 | Unclassified | 10252 |
| 58 | Ga0466698_301036 | 3300042610 | Bacteria | 1134 |
| 59 | Ga0466697_041327 | 3300042611 | Bacteria | 2664 |
| 60 | Ga0123355_10511145 | 3300009826 | Bacteria | 1476 |
| 61 | Ga0123353_10937643 | 3300010167 | Unclassified | 1173 |
| 62 | Ga0123353_10969524 | 3300010167 | Bacteria | 1147 |
| 63 | Ga0123354_10499853 | 3300010882 | Bacteria | 948 |
| 64 | Ga0123354_10519778 | 3300010882 | Unclassified | 915 |
| 65 | Ga0466690_095641 | 3300042590 | Bacteria | 2040 |
| 66 | Ga0466694_119093 | 3300042594 | Bacteria | 1110 |
| 67 | Ga0466694_153008 | 3300042594 | Bacteria | 1400 |
| 68 | Ga0466699_104136 | 3300042597 | Bacteria | 1080 |
| 69 | Ga0466712_302584 | 3300042614 | Bacteria | 1345 |
| 70 | Ga0466731_243497 | 3300042622 | Bacteria | 1142 |
| 71 | JGI24699J35502_10817725 | 3300002509 | Unclassified | 904 |
| 72 | Ga0072940_1012957 | 3300005200 | Bacteria | 3826 |
| 73 | Ga0466717_269849 | 3300042604 | Unclassified | 1076 |
| 74 | Ga0466722_088787 | 3300042609 | Bacteria | 1622 |
| 75 | Ga0466697_017448 | 3300042611 | Unclassified | 1006 |
| 76 | Ga0123353_11043485 | 3300010167 | Bacteria | 1093 |
| 77 | Ga0466690_066887 | 3300042590 | Bacteria | 2509 |
| 78 | Ga0466694_145820 | 3300042594 | Bacteria | 1469 |
| 79 | Ga0466718_133484 | 3300042617 | Bacteria | 1060 |
| 80 | Ga0466723_007216 | 3300042618 | Bacteria | 3319 |
| 81 | Ga0466731_210128 | 3300042622 | Bacteria | 1164 |
| 82 | Ga0466731_409199 | 3300042622 | Bacteria | 1215 |
| 83 | Ga0466734_001536 | 3300042623 | Unclassified | 1053 |
| 84 | Ga0466735_113385 | 3300042624 | Bacteria | 1244 |
| 85 | Ga0466703_261413 | 3300042636 | Bacteria | 1548 |
| 86 | Ga0466725_169552 | 3300042654 | Bacteria | 1118 |
| 87 | Ga0466725_460278 | 3300042654 | Unclassified | 1142 |
| 88 | Ga0466701_024322 | 3300042598 | Bacteria | 1048 |
| 89 | Ga0466700_271911 | 3300042600 | Bacteria | 1729 |
| 90 | Ga0466698_025820 | 3300042610 | Unclassified | 2468 |
| 91 | Ga0466697_275398 | 3300042611 | Bacteria | 1127 |
| 92 | Ga0123356_10779352 | 3300010049 | Bacteria | 1127 |
| 93 | Ga0123353_11056297 | 3300010167 | Bacteria | 1084 |
| 94 | Ga0466656_307288 | 3300042550 | Bacteria | 1079 |
| 95 | Ga0466656_359919 | 3300042550 | Bacteria | 1598 |
| 96 | Ga0466695_281449 | 3300042595 | Bacteria | 1243 |
| 97 | Ga0466695_380620 | 3300042595 | Bacteria | 1544 |
| 98 | Ga0466699_118996 | 3300042597 | Unclassified | 1138 |
| 99 | Ga0466731_373070 | 3300042622 | Unclassified | 1080 |
| 100 | JGI24695J34938_10214875 | 3300002450 | Unclassified | 804 |
| 101 | JGI24702J35022_10398714 | 3300002462 | Bacteria | 831 |
| 102 | JGI24696J40584_12756789 | 3300002834 | Bacteria | 802 |
| 103 | Ga0466701_020302 | 3300042598 | Bacteria | 2287 |
| 104 | Ga0466700_008477 | 3300042600 | Bacteria | 1142 |
| 105 | Ga0466722_224755 | 3300042609 | Bacteria | 3084 |
| 106 | Ga0466697_164937 | 3300042611 | Unclassified | 1214 |
| 107 | Ga0123357_10281884 | 3300009784 | Bacteria | 1715 |
| 108 | Ga0466657_147068 | 3300042582 | Bacteria | 1005 |
| 109 | Ga0466699_047774 | 3300042597 | Bacteria | 1078 |
| 110 | Ga0466718_138798 | 3300042617 | Bacteria | 1897 |
| 111 | Ga0466731_240522 | 3300042622 | Bacteria | 1244 |
| 112 | Ga0466731_322184 | 3300042622 | Bacteria | 1481 |
| 113 | Ga0466725_274418 | 3300042654 | Bacteria | 1251 |
| 114 | JGI24702J35022_10235415 | 3300002462 | Bacteria | 1060 |
| 115 | JGI24702J35022_10419450 | 3300002462 | Unclassified | 811 |
| 116 | Ga0072941_1485142 | 3300005201 | Bacteria | 1390 |
| 117 | Ga0466717_301300 | 3300042604 | Bacteria | 1054 |
| 118 | Ga0466721_029261 | 3300042608 | Unclassified | 1248 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042654 | Ga0466725_460278 | Ga0466725_460278_238_906 | 222 |
| 2 | 3300042636 | Ga0466703_064376 | Ga0466703_064376_2505_3176 | 223 |
| 3 | 3300024582 | Ga0265387_1005147 | Ga0265387_10051472 | 224 |
| 4 | 3300010882 | Ga0123354_10499853 | Ga0123354_104998531 | 225 |
| 5 | 3300042597 | Ga0466699_443576 | Ga0466699_443576_194_895 | 227 |
| 6 | 3300042618 | Ga0466723_007216 | Ga0466723_007216_2367_3050 | 227 |
| 7 | 3300042659 | Ga0466733_031526 | Ga0466733_031526_3345_4031 | 228 |
| 8 | 3300042622 | Ga0466731_240522 | Ga0466731_240522_102_797 | 231 |
| 9 | 2225789004 | 2227381921 | 2227827233 | 233 |
| 10 | 3300038395 | Ga0415639_078746 | Ga0415639_078746_32_733 | 233 |
| 11 | 3300042550 | Ga0466656_001678 | Ga0466656_001678_356_1057 | 233 |
| 12 | 3300042550 | Ga0466656_151982 | Ga0466656_151982_398_1099 | 233 |
| 13 | 3300042550 | Ga0466656_307288 | Ga0466656_307288_175_876 | 233 |
| 14 | 3300042550 | Ga0466656_359919 | Ga0466656_359919_180_881 | 233 |
| 15 | 3300042582 | Ga0466657_147068 | Ga0466657_147068_23_724 | 233 |
| 16 | 3300042590 | Ga0466690_066887 | Ga0466690_066887_1457_2158 | 233 |
| 17 | 3300042590 | Ga0466690_095641 | Ga0466690_095641_1159_1860 | 233 |
| 18 | 3300042593 | Ga0466691_040980 | Ga0466691_040980_708_1409 | 233 |
| 19 | 3300042594 | Ga0466694_071711 | Ga0466694_071711_173_874 | 233 |
| 20 | 3300042594 | Ga0466694_119093 | Ga0466694_119093_224_925 | 233 |
| 21 | 3300042594 | Ga0466694_145820 | Ga0466694_145820_262_963 | 233 |
| 22 | 3300042594 | Ga0466694_153008 | Ga0466694_153008_491_1192 | 233 |
| 23 | 3300042595 | Ga0466695_067693 | Ga0466695_067693_92_793 | 233 |
| 24 | 3300042595 | Ga0466695_380620 | Ga0466695_380620_747_1448 | 233 |
| 25 | 3300042597 | Ga0466699_047774 | Ga0466699_047774_152_853 | 233 |
| 26 | 3300042597 | Ga0466699_104136 | Ga0466699_104136_124_825 | 233 |
| 27 | 3300042597 | Ga0466699_118996 | Ga0466699_118996_217_918 | 233 |
| 28 | 3300042597 | Ga0466699_160314 | Ga0466699_160314_91_792 | 233 |
| 29 | 3300042597 | Ga0466699_263246 | Ga0466699_263246_237_938 | 233 |
| 30 | 3300042598 | Ga0466701_020302 | Ga0466701_020302_435_1136 | 233 |
| 31 | 3300042598 | Ga0466701_024322 | Ga0466701_024322_204_905 | 233 |
| 32 | 3300042600 | Ga0466700_008477 | Ga0466700_008477_254_955 | 233 |
| 33 | 3300042600 | Ga0466700_101856 | Ga0466700_101856_231_932 | 233 |
| 34 | 3300042600 | Ga0466700_271911 | Ga0466700_271911_776_1477 | 233 |
| 35 | 3300042603 | Ga0466714_118030 | Ga0466714_118030_334_1035 | 233 |
| 36 | 3300042604 | Ga0466717_143136 | Ga0466717_143136_299_1000 | 233 |
| 37 | 3300042604 | Ga0466717_269849 | Ga0466717_269849_97_798 | 233 |
| 38 | 3300042604 | Ga0466717_301300 | Ga0466717_301300_204_905 | 233 |
| 39 | 3300042608 | Ga0466721_029261 | Ga0466721_029261_166_867 | 233 |
| 40 | 3300042608 | Ga0466721_040254 | Ga0466721_040254_258_959 | 233 |
| 41 | 3300042608 | Ga0466721_177964 | Ga0466721_177964_381_1082 | 233 |
| 42 | 3300042609 | Ga0466722_014038 | Ga0466722_014038_2715_3416 | 233 |
| 43 | 3300042609 | Ga0466722_025279 | Ga0466722_025279_1356_2057 | 233 |
| 44 | 3300042609 | Ga0466722_224755 | Ga0466722_224755_1645_2346 | 233 |
| 45 | 3300042610 | Ga0466698_025820 | Ga0466698_025820_576_1277 | 233 |
| 46 | 3300042610 | Ga0466698_301036 | Ga0466698_301036_279_980 | 233 |
| 47 | 3300042611 | Ga0466697_017448 | Ga0466697_017448_254_955 | 233 |
| 48 | 3300042611 | Ga0466697_041327 | Ga0466697_041327_1950_2651 | 233 |
| 49 | 3300042611 | Ga0466697_164937 | Ga0466697_164937_158_859 | 233 |
| 50 | 3300042611 | Ga0466697_205519 | Ga0466697_205519_296_997 | 233 |
| 51 | 3300042611 | Ga0466697_275398 | Ga0466697_275398_374_1075 | 233 |
| 52 | 3300042612 | Ga0466705_037596 | Ga0466705_037596_2726_3427 | 233 |
| 53 | 3300042614 | Ga0466712_302584 | Ga0466712_302584_519_1220 | 233 |
| 54 | 3300042617 | Ga0466718_133484 | Ga0466718_133484_117_818 | 233 |
| 55 | 3300042617 | Ga0466718_138798 | Ga0466718_138798_1003_1704 | 233 |
| 56 | 3300042618 | Ga0466723_151866 | Ga0466723_151866_434_1135 | 233 |
| 57 | 3300042622 | Ga0466731_210128 | Ga0466731_210128_284_985 | 233 |
| 58 | 3300042622 | Ga0466731_322184 | Ga0466731_322184_139_840 | 233 |
| 59 | 3300042622 | Ga0466731_373070 | Ga0466731_373070_168_869 | 233 |
| 60 | 3300042623 | Ga0466734_001536 | Ga0466734_001536_284_985 | 233 |
| 61 | 3300042623 | Ga0466734_098270 | Ga0466734_098270_204_905 | 233 |
| 62 | 3300042623 | Ga0466734_141594 | Ga0466734_141594_137_838 | 233 |
| 63 | 3300042624 | Ga0466735_154739 | Ga0466735_154739_317_1018 | 233 |
| 64 | 3300042635 | Ga0466702_196853 | Ga0466702_196853_105_806 | 233 |
| 65 | 3300042636 | Ga0466703_005424 | Ga0466703_005424_236_937 | 233 |
| 66 | 3300042636 | Ga0466703_148946 | Ga0466703_148946_993_1694 | 233 |
| 67 | 3300042636 | Ga0466703_261413 | Ga0466703_261413_318_1019 | 233 |
| 68 | 3300042643 | Ga0466704_155527 | Ga0466704_155527_1871_2572 | 233 |
| 69 | 3300042649 | Ga0466724_40624 | Ga0466724_40624_485_1186 | 233 |
| 70 | 3300042654 | Ga0466725_169552 | Ga0466725_169552_17_718 | 233 |
| 71 | 3300042654 | Ga0466725_274418 | Ga0466725_274418_291_992 | 233 |
| 72 | 3300042659 | Ga0466733_119664 | Ga0466733_119664_123_824 | 233 |
| 73 | 3300042659 | Ga0466733_190358 | Ga0466733_190358_309_1010 | 233 |
| 74 | iso_pr_bacteria | 2864804954 | 2864808084 | 233 |
| 75 | iso_pr_bacteria | 3003178663 | 3003181693 | 233 |
| 76 | iso_pr_bacteria | 3003178663 | 3003181697 | 233 |
| 77 | iso_pr_bacteria | 3003178663 | 3003181706 | 233 |
| 78 | 2225789003 | 2227042601 | 2227402263 | 234 |
| 79 | 2225789004 | 2227486184 | 2227952757 | 234 |
| 80 | 3300000062 | IMNBL1DRAFT_c0049324 | IMNBL1DRAFT_00493242 | 234 |
| 81 | 3300000062 | IMNBL1DRAFT_c0060576 | IMNBL1DRAFT_00605761 | 234 |
| 82 | 3300000062 | IMNBL1DRAFT_c0086355 | IMNBL1DRAFT_00863551 | 234 |
| 83 | 3300002450 | JGI24695J34938_10200269 | JGI24695J34938_102002691 | 234 |
| 84 | 3300002450 | JGI24695J34938_10214875 | JGI24695J34938_102148751 | 234 |
| 85 | 3300002462 | JGI24702J35022_10235415 | JGI24702J35022_102354152 | 234 |
| 86 | 3300002462 | JGI24702J35022_10398714 | JGI24702J35022_103987141 | 234 |
| 87 | 3300002462 | JGI24702J35022_10419450 | JGI24702J35022_104194501 | 234 |
| 88 | 3300002509 | JGI24699J35502_10817725 | JGI24699J35502_108177251 | 234 |
| 89 | 3300002834 | JGI24696J40584_12756789 | JGI24696J40584_127567891 | 234 |
| 90 | 3300005071 | Ga0068302_10076422 | Ga0068302_100764221 | 234 |
| 91 | 3300005200 | Ga0072940_1012957 | Ga0072940_10129571 | 234 |
| 92 | 3300005201 | Ga0072941_1485142 | Ga0072941_14851423 | 234 |
| 93 | 3300009784 | Ga0123357_10281884 | Ga0123357_102818842 | 234 |
| 94 | 3300009784 | Ga0123357_10426016 | Ga0123357_104260161 | 234 |
| 95 | 3300009826 | Ga0123355_10554677 | Ga0123355_105546772 | 234 |
| 96 | 3300010049 | Ga0123356_10110601 | Ga0123356_101106014 | 234 |
| 97 | 3300010049 | Ga0123356_10609316 | Ga0123356_106093162 | 234 |
| 98 | 3300010049 | Ga0123356_10779352 | Ga0123356_107793522 | 234 |
| 99 | 3300010049 | Ga0123356_10872393 | Ga0123356_108723932 | 234 |
| 100 | 3300010049 | Ga0123356_11794431 | Ga0123356_117944311 | 234 |
| 101 | 3300010167 | Ga0123353_10937643 | Ga0123353_109376432 | 234 |
| 102 | 3300010167 | Ga0123353_10969524 | Ga0123353_109695242 | 234 |
| 103 | 3300010167 | Ga0123353_11043485 | Ga0123353_110434851 | 234 |
| 104 | 3300010167 | Ga0123353_11056297 | Ga0123353_110562971 | 234 |
| 105 | 3300010882 | Ga0123354_10519778 | Ga0123354_105197782 | 234 |
| 106 | 3300042595 | Ga0466695_281449 | Ga0466695_281449_354_1058 | 234 |
| 107 | 3300042598 | Ga0466701_077907 | Ga0466701_077907_187_891 | 234 |
| 108 | 3300042601 | Ga0466707_401462 | Ga0466707_401462_301_1005 | 234 |
| 109 | 3300042609 | Ga0466722_088787 | Ga0466722_088787_119_823 | 234 |
| 110 | 3300042624 | Ga0466735_113385 | Ga0466735_113385_338_1042 | 234 |
| 111 | 3300042659 | Ga0466733_118319 | Ga0466733_118319_159_863 | 234 |
| 112 | 3300000062 | IMNBL1DRAFT_c0042688 | IMNBL1DRAFT_00426881 | 235 |
| 113 | 3300042622 | Ga0466731_243497 | Ga0466731_243497_262_978 | 238 |
| 114 | 3300042622 | Ga0466731_409199 | Ga0466731_409199_351_1070 | 239 |
| 115 | 3300042617 | Ga0466718_125739 | Ga0466718_125739_133_858 | 241 |
| 116 | 3300009826 | Ga0123355_10511145 | Ga0123355_105111451 | 242 |
| 117 | 3300042613 | Ga0466710_103481 | Ga0466710_103481_166_897 | 243 |
| 118 | 3300042617 | Ga0466718_093775 | Ga0466718_093775_69_800 | 243 |
| 119 | 3300002462 | JGI24702J35022_10356047 | JGI24702J35022_103560471 | 246 |
| 120 | 3300024582 | Ga0265387_1002891 | Ga0265387_10028912 | 250 |
| 121 | 3300042597 | Ga0466699_049495 | Ga0466699_049495_332_1138 | 268 |
| 122 | 3300042595 | Ga0466695_324772 | Ga0466695_324772_145_975 | 276 |
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF03811 | GO:0006313 | DNA transposition | BP |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.66 | 0.74 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.