Protein Family IF05078
Metagenome
Isolate
108
Members
43
Samples
107
Scaffolds
215.51
Avg Length
Representative Sequence
- ID
- 3300042595|Ga0466695_259131|Ga0466695_259131_106_822
- Length
- 238 aa
- Sequence
- VPAFKKTQLKPHLKACWCIPPEQNGAFVAAMEDVLAVYARARDPLRPVVCMDEKPYQLLGEARDPLPARPGSVEKVDNEYERHGTCSIFLFTEPLAAWRHARARGQRTKRDWALFIQWLLDEQYPAAEKVVLVMDNLNTHGIGALYEAFSAEEAFRLAQRLEIHFTPKHGSWLNIAEMELSALAVQCLGQRRIENLDVLNTELALWDVRRNASQKGVDWHFTTADARKKLKRLYPVIL
Sample Types
Isolate
0.9%
Metagenome
99.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
64.3%
Kalotermitidae
19.0%
Termopsidae
4.8%
Unclassified
4.8%
Rhinotermitidae
2.4%
Hodotermitidae
2.4%
Passalidae
2.4%
Taxonomy
Archaea
11
Bacteria
84
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 5 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 6 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 7 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 8 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 9 | 2820229114 | Unclassified Firmicutes Th196P4bin40 | Isolate | Unclassified |
| 10 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 11 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 12 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 13 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 14 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 15 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 16 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 17 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 18 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 19 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 20 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 21 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 22 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 23 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 24 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 25 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 26 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 27 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 28 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 29 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 30 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 31 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 32 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 33 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 34 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 35 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 36 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 37 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 38 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 39 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 40 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 41 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 42 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 43 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123357_10518708 | 3300009784 | Bacteria | 975 |
| 2 | Ga0123354_10368794 | 3300010882 | Archaea | 1256 |
| 3 | Ga0466701_046665 | 3300042598 | Bacteria | 1139 |
| 4 | Ga0466701_059204 | 3300042598 | Archaea | 1242 |
| 5 | Ga0466700_111949 | 3300042600 | Unclassified | 1249 |
| 6 | Ga0466734_104224 | 3300042623 | Bacteria | 1884 |
| 7 | Ga0466724_26226 | 3300042649 | Unclassified | 1205 |
| 8 | JGI24702J35022_10119177 | 3300002462 | Bacteria | 1457 |
| 9 | JGI24703J35330_11441638 | 3300002501 | Archaea | 1018 |
| 10 | JGI24696J40584_12911809 | 3300002834 | Archaea | 1262 |
| 11 | Ga0466693_324347 | 3300042592 | Bacteria | 2399 |
| 12 | Ga0123355_10842037 | 3300009826 | Bacteria | 1011 |
| 13 | Ga0123356_10067444 | 3300010049 | Bacteria | 3351 |
| 14 | Ga0123354_10321414 | 3300010882 | Bacteria | 1427 |
| 15 | Ga0466706_198382 | 3300042599 | Unclassified | 1476 |
| 16 | Ga0466714_049338 | 3300042603 | Bacteria | 1492 |
| 17 | Ga0466714_123029 | 3300042603 | Bacteria | 1455 |
| 18 | Ga0466714_127245 | 3300042603 | Bacteria | 1203 |
| 19 | Ga0466719_330320 | 3300042606 | Bacteria | 2264 |
| 20 | Ga0466715_451344 | 3300042616 | Bacteria | 2283 |
| 21 | Ga0466726_059489 | 3300042619 | Bacteria | 20046 |
| 22 | Ga0466728_272573 | 3300042620 | Bacteria | 1229 |
| 23 | Ga0466725_430677 | 3300042654 | Bacteria | 1318 |
| 24 | JGI24705J35276_12191779 | 3300002504 | Bacteria | 1479 |
| 25 | Ga0123356_10473188 | 3300010049 | Archaea | 1405 |
| 26 | Ga0123356_10486186 | 3300010049 | Bacteria | 1388 |
| 27 | Ga0123353_10574955 | 3300010167 | Bacteria | 1618 |
| 28 | Ga0123353_10862576 | 3300010167 | Unclassified | 1239 |
| 29 | Ga0466700_049649 | 3300042600 | Bacteria | 1238 |
| 30 | Ga0466731_242841 | 3300042622 | Unclassified | 2313 |
| 31 | Ga0466703_372572 | 3300042636 | Unclassified | 1457 |
| 32 | JGI24705J35276_12166082 | 3300002504 | Bacteria | 1261 |
| 33 | JGI24696J40584_12911651 | 3300002834 | Bacteria | 1261 |
| 34 | Ga0466701_010799 | 3300042598 | Archaea | 1738 |
| 35 | Ga0123356_10488726 | 3300010049 | Bacteria | 1385 |
| 36 | Ga0123354_10235365 | 3300010882 | Bacteria | 1902 |
| 37 | Ga0123354_10369691 | 3300010882 | Bacteria | 1253 |
| 38 | Ga0466701_042540 | 3300042598 | Archaea | 1434 |
| 39 | Ga0466726_176660 | 3300042619 | Bacteria | 2062 |
| 40 | IMNBL1DRAFT_c0029435 | 3300000062 | Bacteria | 2031 |
| 41 | JGI24695J34938_10086521 | 3300002450 | Bacteria | 1290 |
| 42 | Ga0264413_106417 | 3300024493 | Bacteria | 4382 |
| 43 | Ga0415639_105968 | 3300038395 | Bacteria | 2449 |
| 44 | Ga0466656_259915 | 3300042550 | Bacteria | 1452 |
| 45 | Ga0466690_176928 | 3300042590 | Bacteria | 6358 |
| 46 | Ga0466691_001454 | 3300042593 | Bacteria | 5050 |
| 47 | Ga0466695_259131 | 3300042595 | Bacteria | 1396 |
| 48 | Ga0466695_396919 | 3300042595 | Bacteria | 1079 |
| 49 | Ga0123355_10507162 | 3300009826 | Bacteria | 1484 |
| 50 | Ga0123356_10243687 | 3300010049 | Bacteria | 1870 |
| 51 | Ga0123356_10410188 | 3300010049 | Bacteria | 1494 |
| 52 | Ga0123353_10557952 | 3300010167 | Archaea | 1650 |
| 53 | Ga0123353_10713668 | 3300010167 | Bacteria | 1404 |
| 54 | Ga0123353_10820499 | 3300010167 | Bacteria | 1280 |
| 55 | Ga0466700_054387 | 3300042600 | Bacteria | 2891 |
| 56 | Ga0466700_115015 | 3300042600 | Bacteria | 1485 |
| 57 | Ga0466716_115026 | 3300042605 | Bacteria | 1949 |
| 58 | Ga0466715_070262 | 3300042616 | Bacteria | 2262 |
| 59 | Ga0466734_076475 | 3300042623 | Bacteria | 1746 |
| 60 | Ga0415639_034058 | 3300038395 | Bacteria | 1451 |
| 61 | Ga0123355_10580196 | 3300009826 | Bacteria | 1341 |
| 62 | Ga0123356_10134152 | 3300010049 | Unclassified | 2430 |
| 63 | Ga0123356_10355165 | 3300010049 | Bacteria | 1591 |
| 64 | Ga0123353_10479676 | 3300010167 | Bacteria | 1820 |
| 65 | Ga0466706_033905 | 3300042599 | Bacteria | 1763 |
| 66 | Ga0466706_169357 | 3300042599 | Bacteria | 1199 |
| 67 | Ga0466700_157948 | 3300042600 | Bacteria | 1515 |
| 68 | Ga0466712_155811 | 3300042614 | Unclassified | 3084 |
| 69 | Ga0466726_190839 | 3300042619 | Unclassified | 3989 |
| 70 | Ga0466729_209349 | 3300042621 | Bacteria | 1513 |
| 71 | Ga0466734_062899 | 3300042623 | Bacteria | 1652 |
| 72 | Ga0466702_096884 | 3300042635 | Bacteria | 1568 |
| 73 | JGI24702J35022_10025915 | 3300002462 | Bacteria | 3162 |
| 74 | Ga0068302_10147413 | 3300005071 | Bacteria | 1313 |
| 75 | Ga0466691_151112 | 3300042593 | Bacteria | 4746 |
| 76 | Ga0123357_10380705 | 3300009784 | Bacteria | 1310 |
| 77 | Ga0123356_10254611 | 3300010049 | Bacteria | 1835 |
| 78 | Ga0123356_10634727 | 3300010049 | Bacteria | 1234 |
| 79 | Ga0123356_10710503 | 3300010049 | Bacteria | 1174 |
| 80 | Ga0123353_10475248 | 3300010167 | Bacteria | 1831 |
| 81 | Ga0123353_10639468 | 3300010167 | Bacteria | 1509 |
| 82 | Ga0123354_10248240 | 3300010882 | Bacteria | 1811 |
| 83 | Ga0466701_027691 | 3300042598 | Bacteria | 1800 |
| 84 | Ga0466701_047426 | 3300042598 | Bacteria | 3795 |
| 85 | Ga0466701_051252 | 3300042598 | Bacteria | 2271 |
| 86 | Ga0466714_159100 | 3300042603 | Bacteria | 1588 |
| 87 | Ga0466717_107366 | 3300042604 | Archaea | 1028 |
| 88 | Ga0466719_043334 | 3300042606 | Unclassified | 2358 |
| 89 | Ga0466710_206849 | 3300042613 | Bacteria | 1385 |
| 90 | Ga0466729_078631 | 3300042621 | Bacteria | 1507 |
| 91 | Ga0466734_055493 | 3300042623 | Bacteria | 2678 |
| 92 | Ga0466725_221434 | 3300042654 | Archaea | 1058 |
| 93 | Ga0466699_131319 | 3300042597 | Bacteria | 5275 |
| 94 | Ga0123356_10192074 | 3300010049 | Bacteria | 2074 |
| 95 | Ga0123353_10328387 | 3300010167 | Unclassified | 2317 |
| 96 | Ga0123353_10367930 | 3300010167 | Bacteria | 2157 |
| 97 | Ga0123353_10519229 | 3300010167 | Unclassified | 1729 |
| 98 | Ga0123353_11736940 | 3300010167 | Bacteria | 779 |
| 99 | Ga0466700_072590 | 3300042600 | Bacteria | 2830 |
| 100 | Ga0466707_161987 | 3300042601 | Archaea | 1587 |
| 101 | Ga0466717_103153 | 3300042604 | Bacteria | 1082 |
| 102 | Ga0466698_364366 | 3300042610 | Bacteria | 1351 |
| 103 | Ga0466705_208976 | 3300042612 | Unclassified | 1841 |
| 104 | Ga0466728_286767 | 3300042620 | Bacteria | 3119 |
| 105 | JGI24695J34938_10092896 | 3300002450 | Bacteria | 1237 |
| 106 | JGI24702J35022_10019856 | 3300002462 | Bacteria | 3654 |
| 107 | Ga0466699_429292 | 3300042597 | Bacteria | 1435 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042623 | Ga0466734_076475 | Ga0466734_076475_826_1452 | 199 |
| 2 | 3300024493 | Ga0264413_106417 | Ga0264413_1064174 | 201 |
| 3 | 3300038395 | Ga0415639_034058 | Ga0415639_034058_159_773 | 204 |
| 4 | 3300010167 | Ga0123353_10328387 | Ga0123353_103283873 | 205 |
| 5 | 3300042619 | Ga0466726_176660 | Ga0466726_176660_751_1371 | 206 |
| 6 | 3300002834 | JGI24696J40584_12911809 | JGI24696J40584_129118091 | 207 |
| 7 | 3300009826 | Ga0123355_10842037 | Ga0123355_108420372 | 207 |
| 8 | 3300010049 | Ga0123356_10134152 | Ga0123356_101341523 | 207 |
| 9 | 3300010167 | Ga0123353_10639468 | Ga0123353_106394682 | 207 |
| 10 | 3300010049 | Ga0123356_10243687 | Ga0123356_102436872 | 208 |
| 11 | 3300042595 | Ga0466695_396919 | Ga0466695_396919_222_848 | 208 |
| 12 | 3300042597 | Ga0466699_131319 | Ga0466699_131319_694_1320 | 208 |
| 13 | 3300042597 | Ga0466699_429292 | Ga0466699_429292_109_735 | 208 |
| 14 | 3300042598 | Ga0466701_010799 | Ga0466701_010799_293_919 | 208 |
| 15 | 3300042598 | Ga0466701_047426 | Ga0466701_047426_238_864 | 208 |
| 16 | 3300042600 | Ga0466700_111949 | Ga0466700_111949_558_1184 | 208 |
| 17 | 3300042600 | Ga0466700_115015 | Ga0466700_115015_82_708 | 208 |
| 18 | 3300042600 | Ga0466700_157948 | Ga0466700_157948_666_1292 | 208 |
| 19 | 3300042604 | Ga0466717_107366 | Ga0466717_107366_358_984 | 208 |
| 20 | 3300042614 | Ga0466712_155811 | Ga0466712_155811_639_1265 | 208 |
| 21 | 3300042616 | Ga0466715_070262 | Ga0466715_070262_662_1288 | 208 |
| 22 | 3300042620 | Ga0466728_272573 | Ga0466728_272573_45_671 | 208 |
| 23 | 3300042635 | Ga0466702_096884 | Ga0466702_096884_281_907 | 208 |
| 24 | 3300042636 | Ga0466703_372572 | Ga0466703_372572_127_753 | 208 |
| 25 | 3300042649 | Ga0466724_26226 | Ga0466724_26226_65_691 | 208 |
| 26 | 3300042654 | Ga0466725_221434 | Ga0466725_221434_377_1003 | 208 |
| 27 | 3300000062 | IMNBL1DRAFT_c0029435 | IMNBL1DRAFT_00294352 | 209 |
| 28 | 3300002450 | JGI24695J34938_10092896 | JGI24695J34938_100928961 | 209 |
| 29 | 3300002501 | JGI24703J35330_11441638 | JGI24703J35330_114416381 | 209 |
| 30 | 3300002834 | JGI24696J40584_12911651 | JGI24696J40584_129116511 | 209 |
| 31 | 3300009826 | Ga0123355_10507162 | Ga0123355_105071621 | 209 |
| 32 | 3300010049 | Ga0123356_10067444 | Ga0123356_100674444 | 209 |
| 33 | 3300010049 | Ga0123356_10192074 | Ga0123356_101920743 | 209 |
| 34 | 3300010049 | Ga0123356_10473188 | Ga0123356_104731881 | 209 |
| 35 | 3300010049 | Ga0123356_10486186 | Ga0123356_104861862 | 209 |
| 36 | 3300010049 | Ga0123356_10634727 | Ga0123356_106347271 | 209 |
| 37 | 3300010167 | Ga0123353_10367930 | Ga0123353_103679302 | 209 |
| 38 | 3300010882 | Ga0123354_10321414 | Ga0123354_103214141 | 209 |
| 39 | 3300010882 | Ga0123354_10368794 | Ga0123354_103687942 | 209 |
| 40 | 3300042590 | Ga0466690_176928 | Ga0466690_176928_4260_4889 | 209 |
| 41 | 3300042593 | Ga0466691_151112 | Ga0466691_151112_212_841 | 209 |
| 42 | 3300042601 | Ga0466707_161987 | Ga0466707_161987_884_1513 | 209 |
| 43 | 3300042605 | Ga0466716_115026 | Ga0466716_115026_245_874 | 209 |
| 44 | 3300042606 | Ga0466719_043334 | Ga0466719_043334_1535_2164 | 209 |
| 45 | 3300042612 | Ga0466705_208976 | Ga0466705_208976_530_1159 | 209 |
| 46 | 3300042616 | Ga0466715_451344 | Ga0466715_451344_406_1035 | 209 |
| 47 | 3300042619 | Ga0466726_190839 | Ga0466726_190839_775_1404 | 209 |
| 48 | 3300042620 | Ga0466728_286767 | Ga0466728_286767_773_1402 | 209 |
| 49 | 3300042621 | Ga0466729_078631 | Ga0466729_078631_583_1212 | 209 |
| 50 | 3300042654 | Ga0466725_430677 | Ga0466725_430677_642_1271 | 209 |
| 51 | 3300038395 | Ga0415639_105968 | Ga0415639_105968_1506_2138 | 210 |
| 52 | 3300042550 | Ga0466656_259915 | Ga0466656_259915_648_1280 | 210 |
| 53 | 3300042592 | Ga0466693_324347 | Ga0466693_324347_1022_1654 | 210 |
| 54 | 3300042598 | Ga0466701_059204 | Ga0466701_059204_359_991 | 210 |
| 55 | 3300042600 | Ga0466700_049649 | Ga0466700_049649_17_649 | 210 |
| 56 | 3300042610 | Ga0466698_364366 | Ga0466698_364366_630_1262 | 210 |
| 57 | 3300042623 | Ga0466734_055493 | Ga0466734_055493_71_703 | 210 |
| 58 | 3300042623 | Ga0466734_062899 | Ga0466734_062899_969_1601 | 210 |
| 59 | 3300002450 | JGI24695J34938_10086521 | JGI24695J34938_100865212 | 211 |
| 60 | 3300010167 | Ga0123353_10475248 | Ga0123353_104752483 | 211 |
| 61 | 3300010167 | Ga0123353_10862576 | Ga0123353_108625761 | 211 |
| 62 | 3300042619 | Ga0466726_059489 | Ga0466726_059489_6749_7384 | 211 |
| 63 | 3300002462 | JGI24702J35022_10025915 | JGI24702J35022_100259153 | 212 |
| 64 | 3300042593 | Ga0466691_001454 | Ga0466691_001454_4380_5018 | 212 |
| 65 | 3300042606 | Ga0466719_330320 | Ga0466719_330320_600_1238 | 212 |
| 66 | 3300010882 | Ga0123354_10369691 | Ga0123354_103696911 | 213 |
| 67 | 3300042598 | Ga0466701_046665 | Ga0466701_046665_255_905 | 216 |
| 68 | 3300042600 | Ga0466700_054387 | Ga0466700_054387_1216_1881 | 221 |
| 69 | 3300042603 | Ga0466714_123029 | Ga0466714_123029_88_753 | 221 |
| 70 | 3300042603 | Ga0466714_159100 | Ga0466714_159100_314_979 | 221 |
| 71 | 3300042623 | Ga0466734_104224 | Ga0466734_104224_100_765 | 221 |
| 72 | 3300005071 | Ga0068302_10147413 | Ga0068302_101474131 | 222 |
| 73 | 3300042598 | Ga0466701_042540 | Ga0466701_042540_160_834 | 224 |
| 74 | 3300042621 | Ga0466729_209349 | Ga0466729_209349_704_1378 | 224 |
| 75 | 3300009784 | Ga0123357_10380705 | Ga0123357_103807052 | 225 |
| 76 | 3300042598 | Ga0466701_051252 | Ga0466701_051252_891_1568 | 225 |
| 77 | 3300042599 | Ga0466706_169357 | Ga0466706_169357_215_892 | 225 |
| 78 | 3300042599 | Ga0466706_198382 | Ga0466706_198382_615_1292 | 225 |
| 79 | 3300042603 | Ga0466714_049338 | Ga0466714_049338_405_1082 | 225 |
| 80 | 3300042603 | Ga0466714_127245 | Ga0466714_127245_464_1141 | 225 |
| 81 | 3300042613 | Ga0466710_206849 | Ga0466710_206849_94_771 | 225 |
| 82 | iso_pr_bacteria | 2820229114 | 2820231038 | 225 |
| 83 | 3300002462 | JGI24702J35022_10019856 | JGI24702J35022_100198567 | 226 |
| 84 | 3300002462 | JGI24702J35022_10119177 | JGI24702J35022_101191773 | 226 |
| 85 | 3300002504 | JGI24705J35276_12166082 | JGI24705J35276_121660821 | 226 |
| 86 | 3300010049 | Ga0123356_10254611 | Ga0123356_102546112 | 226 |
| 87 | 3300010049 | Ga0123356_10355165 | Ga0123356_103551652 | 226 |
| 88 | 3300010049 | Ga0123356_10410188 | Ga0123356_104101882 | 226 |
| 89 | 3300010049 | Ga0123356_10488726 | Ga0123356_104887263 | 226 |
| 90 | 3300010049 | Ga0123356_10710503 | Ga0123356_107105032 | 226 |
| 91 | 3300010167 | Ga0123353_10479676 | Ga0123353_104796762 | 226 |
| 92 | 3300010167 | Ga0123353_10519229 | Ga0123353_105192292 | 226 |
| 93 | 3300010167 | Ga0123353_10574955 | Ga0123353_105749553 | 226 |
| 94 | 3300010167 | Ga0123353_10713668 | Ga0123353_107136681 | 226 |
| 95 | 3300010167 | Ga0123353_10820499 | Ga0123353_108204991 | 226 |
| 96 | 3300010167 | Ga0123353_11736940 | Ga0123353_117369401 | 226 |
| 97 | 3300010882 | Ga0123354_10248240 | Ga0123354_102482402 | 226 |
| 98 | 3300042598 | Ga0466701_027691 | Ga0466701_027691_489_1169 | 226 |
| 99 | 3300042622 | Ga0466731_242841 | Ga0466731_242841_1574_2254 | 226 |
| 100 | 3300002504 | JGI24705J35276_12191779 | JGI24705J35276_121917792 | 227 |
| 101 | 3300009784 | Ga0123357_10518708 | Ga0123357_105187082 | 227 |
| 102 | 3300010167 | Ga0123353_10557952 | Ga0123353_105579521 | 227 |
| 103 | 3300042599 | Ga0466706_033905 | Ga0466706_033905_332_1015 | 227 |
| 104 | 3300042600 | Ga0466700_072590 | Ga0466700_072590_622_1308 | 228 |
| 105 | 3300010882 | Ga0123354_10235365 | Ga0123354_102353652 | 229 |
| 106 | 3300009826 | Ga0123355_10580196 | Ga0123355_105801962 | 230 |
| 107 | 3300042595 | Ga0466695_259131 | Ga0466695_259131_106_822 | 238 |
| 108 | 3300042604 | Ga0466717_103153 | Ga0466717_103153_167_955 | 262 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13358 | DDE_3 | DDE superfamily endonuclease | 47 | 199 | 0.96 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.75 | 0.81 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.