Protein Family IF05035
Metagenome
Isolate
128
Members
43
Samples
124
Scaffolds
256.22
Avg Length
Representative Sequence
- ID
- 3300042594|Ga0466694_293843|Ga0466694_293843_1316_2218
- Length
- 300 aa
- Sequence
- LKKLAHGGKESSDLFVLRGFAMNQDQVKEKLLLLEDAPLDFSVIFSGKKSKKVNGLYKNSSREIIIHNRNFSGGSGGKDADANLLIYTAIHEYAHHLHCCKSGGLLSSRAHTSEFWAILHGLLEKAEKKKIYRNVFFPSNGTGSKELEELTWTIKNKYLAENGKLVKELGQLLLKAYALCSAAGGRYEDYIDRILCIPRQAANLAVKMYQYDLNPEIGADNMRFLAGITNEEKRQVAESSLLNGKSPDMVKTALRKNTQEAKLDDVDPRLVLEKEKLRLERTIAALSKRLEEVKNELTKS
Sample Types
Isolate
1.6%
Metagenome
98.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.9%
Kalotermitidae
32.6%
Rhinotermitidae
9.3%
Unclassified
7.0%
Termopsidae
7.0%
Hodotermitidae
2.3%
Taxonomy
Archaea
0
Bacteria
113
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 2 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 3 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 4 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 5 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 6 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 7 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 8 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 9 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 10 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 11 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 12 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 13 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 14 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 15 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 16 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 17 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 18 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 19 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 20 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 21 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 22 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 23 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 24 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 25 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 26 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 27 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 28 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 29 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 30 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 31 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 32 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 33 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 34 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 35 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 36 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 37 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 38 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 39 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 40 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 41 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 42 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 43 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_055565 | 3300042612 | Bacteria | 1674 |
| 2 | Ga0466729_313128 | 3300042621 | Bacteria | 1146 |
| 3 | JGI24698J34947_10005775 | 3300002449 | Bacteria | 6786 |
| 4 | Ga0466711_201130 | 3300042615 | Bacteria | 2260 |
| 5 | Ga0466723_123393 | 3300042618 | Bacteria | 21773 |
| 6 | Ga0466726_389584 | 3300042619 | Bacteria | 26574 |
| 7 | Ga0466728_002750 | 3300042620 | Bacteria | 5051 |
| 8 | Ga0466706_104853 | 3300042599 | Bacteria | 11742 |
| 9 | Ga0466720_010019 | 3300042607 | Bacteria | 9693 |
| 10 | Ga0466722_015416 | 3300042609 | Bacteria | 6021 |
| 11 | Ga0466694_293843 | 3300042594 | Bacteria | 2388 |
| 12 | Ga0466699_179747 | 3300042597 | Bacteria | 2373 |
| 13 | Ga0466735_179502 | 3300042624 | Bacteria | 1459 |
| 14 | Ga0466703_098819 | 3300042636 | Bacteria | 20257 |
| 15 | Ga0466703_418207 | 3300042636 | Bacteria | 3089 |
| 16 | Ga0466704_037555 | 3300042643 | Bacteria | 8396 |
| 17 | Ga0466704_374728 | 3300042643 | Bacteria | 3698 |
| 18 | Ga0466709_009090 | 3300042648 | Bacteria | 27329 |
| 19 | Ga0466709_079868 | 3300042648 | Bacteria | 3872 |
| 20 | Ga0466708_100692 | 3300042652 | Bacteria | 1267 |
| 21 | Ga0123357_10355691 | 3300009784 | Bacteria | 1394 |
| 22 | Ga0074263_102198 | 3300005485 | Unclassified | 1557 |
| 23 | Ga0074263_108876 | 3300005485 | Unclassified | 3547 |
| 24 | Ga0466718_136727 | 3300042617 | Bacteria | 1581 |
| 25 | Ga0466723_005829 | 3300042618 | Bacteria | 4705 |
| 26 | Ga0466726_364614 | 3300042619 | Bacteria | 2078 |
| 27 | Ga0466700_402041 | 3300042600 | Bacteria | 1671 |
| 28 | Ga0466716_434902 | 3300042605 | Bacteria | 3870 |
| 29 | Ga0466690_423918 | 3300042590 | Bacteria | 1144 |
| 30 | Ga0466694_341551 | 3300042594 | Bacteria | 1624 |
| 31 | Ga0466694_377595 | 3300042594 | Bacteria | 1885 |
| 32 | Ga0466699_222104 | 3300042597 | Bacteria | 2127 |
| 33 | Ga0466731_106106 | 3300042622 | Bacteria | 2146 |
| 34 | Ga0466709_037095 | 3300042648 | Bacteria | 3010 |
| 35 | Ga0466708_283267 | 3300042652 | Bacteria | 8379 |
| 36 | Ga0123353_10841783 | 3300010167 | Bacteria | 1259 |
| 37 | JGI24702J35022_10023330 | 3300002462 | Bacteria | 3346 |
| 38 | Ga0466711_076850 | 3300042615 | Bacteria | 18451 |
| 39 | Ga0466726_494422 | 3300042619 | Bacteria | 1194 |
| 40 | Ga0466728_247086 | 3300042620 | Unclassified | 2127 |
| 41 | Ga0466729_088895 | 3300042621 | Bacteria | 5314 |
| 42 | Ga0466706_023038 | 3300042599 | Bacteria | 3450 |
| 43 | Ga0466719_010034 | 3300042606 | Bacteria | 4144 |
| 44 | Ga0466720_049890 | 3300042607 | Bacteria | 1557 |
| 45 | Ga0466720_107601 | 3300042607 | Bacteria | 2457 |
| 46 | Ga0466720_213180 | 3300042607 | Bacteria | 1776 |
| 47 | Ga0466692_097831 | 3300042591 | Bacteria | 11967 |
| 48 | Ga0466692_159711 | 3300042591 | Bacteria | 7211 |
| 49 | Ga0466699_010407 | 3300042597 | Bacteria | 6309 |
| 50 | Ga0466705_255750 | 3300042612 | Bacteria | 3452 |
| 51 | Ga0466735_028152 | 3300042624 | Bacteria | 4244 |
| 52 | Ga0466735_049795 | 3300042624 | Unclassified | 1147 |
| 53 | Ga0466703_014921 | 3300042636 | Bacteria | 7407 |
| 54 | Ga0466708_153922 | 3300042652 | Bacteria | 2044 |
| 55 | JGI24698J34947_10046323 | 3300002449 | Unclassified | 2213 |
| 56 | Ga0466711_331291 | 3300042615 | Bacteria | 4643 |
| 57 | Ga0466715_237052 | 3300042616 | Bacteria | 14138 |
| 58 | Ga0466726_193954 | 3300042619 | Bacteria | 2479 |
| 59 | Ga0466698_311808 | 3300042610 | Bacteria | 1277 |
| 60 | Ga0466692_041817 | 3300042591 | Bacteria | 11196 |
| 61 | Ga0466699_265474 | 3300042597 | Bacteria | 9682 |
| 62 | Ga0466705_020864 | 3300042612 | Bacteria | 24538 |
| 63 | Ga0466705_187249 | 3300042612 | Bacteria | 3002 |
| 64 | Ga0466703_025371 | 3300042636 | Bacteria | 12872 |
| 65 | Ga0466703_311285 | 3300042636 | Bacteria | 9390 |
| 66 | Ga0466708_035068 | 3300042652 | Bacteria | 6875 |
| 67 | Ga0466708_164685 | 3300042652 | Bacteria | 38582 |
| 68 | Ga0466727_123316 | 3300042655 | Bacteria | 7805 |
| 69 | JGI24698J34947_10004191 | 3300002449 | Unclassified | 7838 |
| 70 | JGI24698J34947_10035026 | 3300002449 | Bacteria | 2623 |
| 71 | Ga0466718_037199 | 3300042617 | Bacteria | 3163 |
| 72 | Ga0466723_129365 | 3300042618 | Unclassified | 2869 |
| 73 | Ga0466723_288814 | 3300042618 | Bacteria | 13535 |
| 74 | Ga0466717_127719 | 3300042604 | Bacteria | 1086 |
| 75 | Ga0466719_316885 | 3300042606 | Bacteria | 4438 |
| 76 | Ga0466720_079904 | 3300042607 | Bacteria | 1166 |
| 77 | Ga0466720_125366 | 3300042607 | Bacteria | 14214 |
| 78 | Ga0466720_150632 | 3300042607 | Unclassified | 2644 |
| 79 | Ga0466690_251152 | 3300042590 | Unclassified | 4548 |
| 80 | Ga0466691_013009 | 3300042593 | Bacteria | 2285 |
| 81 | Ga0466691_227133 | 3300042593 | Bacteria | 8825 |
| 82 | Ga0466703_028466 | 3300042636 | Bacteria | 10144 |
| 83 | Ga0466704_253907 | 3300042643 | Unclassified | 7903 |
| 84 | Ga0123355_10138825 | 3300009826 | Bacteria | 3726 |
| 85 | Ga0123353_10468773 | 3300010167 | Bacteria | 1847 |
| 86 | AustNasuHG_c1001012 | 3300000089 | Bacteria | 10135 |
| 87 | JGI24698J34947_10004441 | 3300002449 | Bacteria | 7637 |
| 88 | Ga0466712_058450 | 3300042614 | Bacteria | 7817 |
| 89 | Ga0466726_040346 | 3300042619 | Unclassified | 1523 |
| 90 | Ga0466728_145011 | 3300042620 | Bacteria | 10777 |
| 91 | Ga0466716_379308 | 3300042605 | Bacteria | 9882 |
| 92 | Ga0466692_204240 | 3300042591 | Bacteria | 36789 |
| 93 | Ga0466694_027240 | 3300042594 | Bacteria | 14900 |
| 94 | Ga0466694_409225 | 3300042594 | Bacteria | 36264 |
| 95 | Ga0466695_028420 | 3300042595 | Bacteria | 3335 |
| 96 | Ga0466699_242890 | 3300042597 | Bacteria | 1130 |
| 97 | Ga0466732_154297 | 3300042656 | Bacteria | 5671 |
| 98 | Ga0466704_106799 | 3300042643 | Unclassified | 4697 |
| 99 | Ga0466708_222588 | 3300042652 | Unclassified | 6815 |
| 100 | Ga0466715_132789 | 3300042616 | Bacteria | 29114 |
| 101 | Ga0466715_351349 | 3300042616 | Bacteria | 8636 |
| 102 | Ga0466707_115940 | 3300042601 | Bacteria | 1388 |
| 103 | Ga0466719_047566 | 3300042606 | Bacteria | 14696 |
| 104 | Ga0466720_228424 | 3300042607 | Bacteria | 12236 |
| 105 | Ga0466690_350427 | 3300042590 | Bacteria | 1567 |
| 106 | Ga0466696_064106 | 3300042596 | Bacteria | 1412 |
| 107 | Ga0466696_226202 | 3300042596 | Bacteria | 3681 |
| 108 | Ga0466705_237181 | 3300042612 | Bacteria | 4225 |
| 109 | Ga0466732_427349 | 3300042656 | Bacteria | 2817 |
| 110 | Ga0123357_10058816 | 3300009784 | Bacteria | 5159 |
| 111 | Ga0123353_10425158 | 3300010167 | Bacteria | 1967 |
| 112 | Ga0466712_069687 | 3300042614 | Bacteria | 15367 |
| 113 | Ga0466712_189763 | 3300042614 | Bacteria | 10684 |
| 114 | Ga0466723_141152 | 3300042618 | Bacteria | 3940 |
| 115 | Ga0466726_423132 | 3300042619 | Bacteria | 1073 |
| 116 | Ga0466706_200433 | 3300042599 | Bacteria | 1628 |
| 117 | Ga0466698_200164 | 3300042610 | Bacteria | 4193 |
| 118 | Ga0456237_0000533 | 3300041968 | Bacteria | 5798 |
| 119 | Ga0466690_035321 | 3300042590 | Bacteria | 5242 |
| 120 | Ga0466691_054723 | 3300042593 | Bacteria | 13333 |
| 121 | Ga0466694_100808 | 3300042594 | Bacteria | 7330 |
| 122 | Ga0466694_267007 | 3300042594 | Unclassified | 3127 |
| 123 | Ga0466696_016858 | 3300042596 | Bacteria | 8735 |
| 124 | Ga0466696_187794 | 3300042596 | Bacteria | 6395 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.