Protein Family IF04976

Metagenome Isolate
325 Members
87 Samples
287 Scaffolds
301.94 Avg Length

🧬 Representative Sequence

ID
3300042594|Ga0466694_064513|Ga0466694_064513_17170_18168
Length
332 aa
Sequence
MIRKEKYLILHNGLFSMNTPLNSLCHIDTNMLKKRRTIMAADGLHALALLLPYGVLFSMFIAVPIAVAIYLSFTYFDLVQAPVFAGLYNYVTLLTQDTVFFKNVLPNTILFALIVGPGGYMISFLMAWMLSQIQPAPRTLLALLLYMPSLAGGVFISVLWRTIFSGNQSGYINAVLLRWNLIQTPIQFLQSPDFLMSIMILVSLWSAMGIGFLAMLAGILNINEELYEAAYIDGLRNRFQEIIYITIPSMKPQMLFGAVMAIVGAFNNGAIGVALSGANPTPQYSGQLITNHIDDYGFLRYEMGYAAAVSVALLCIVWVFSKLAYTFFGERD

πŸ“Š Sample Types

Isolate 11.4%
Metagenome 88.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 32.9%
Unclassified 29.1%
Kalotermitidae 15.2%
Rhinotermitidae 5.1%
Blattidae 3.8%
Armadillidiidae 3.8%
Scarabaeidae 2.5%
Passalidae 2.5%
Termopsidae 2.5%
Culicidae 1.3%
Hodotermitidae 1.3%

🌳 Taxonomy

Archaea 2
Bacteria 278
Eukaryota 0
Viruses 1
Unclassified 44

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
2 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
3 2820541116 Unclassified Firmicutes Lab288P1bin109 Isolate Unclassified
4 2820581541 Unclassified Firmicutes Emb289P3bin127 Isolate Unclassified
5 2820654856 Unclassified Firmicutes Cu122P1bin2 Isolate Unclassified
6 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
7 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
8 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
9 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
10 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
11 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
12 2820298281 Unclassified Firmicutes Th196P1bin9 Isolate Unclassified
13 2820442516 Unclassified Firmicutes Lab288P3bin200 Isolate Unclassified
14 2820696217 Unclassified Firmicutes Co191P1bin66 Isolate Unclassified
15 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
16 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
17 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
18 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
19 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
20 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
21 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
22 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
23 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
24 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
25 2820385248 Unclassified Firmicutes Nt197P1bin19 Isolate Unclassified
26 2820676843 Unclassified Firmicutes Co191P3bin17 Isolate Unclassified
27 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
28 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
29 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
30 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
31 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
32 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
33 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
34 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
35 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
36 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
37 2852337885 Paenibacillus protaetiae FW100M-2 Isolate Scarabaeidae
38 2940413413 Paenibacillus sp. PastH-3 Isolate Blattidae
39 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
40 2820257794 Unclassified Firmicutes Th196P3bin47 Isolate Unclassified
41 2820329821 Unclassified Firmicutes Nt197P3bin77 Isolate Unclassified
42 2820378768 Unclassified Firmicutes Nt197P1bin7 Isolate Unclassified
43 2820627938 Unclassified Firmicutes Emb289P1bin122 Isolate Unclassified
44 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
45 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
46 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
47 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
48 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
49 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
50 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
51 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
52 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
53 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
54 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
55 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
56 2820306284 Unclassified Firmicutes Th196P1bin11 Isolate Unclassified
57 2820405014 Unclassified Firmicutes Lab288P4bin88 Isolate Unclassified
58 2820435670 Unclassified Firmicutes Lab288P3bin217 Isolate Unclassified
59 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
60 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
61 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
62 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
63 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
64 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
65 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
66 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
67 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
68 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
69 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
70 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
71 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
72 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
73 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
74 2576861701 Paenibacillus sp. JCM 10914 Isolate Termitidae
75 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
76 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
77 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
78 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
79 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
80 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
81 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
82 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
83 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
84 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
85 2820600392 Unclassified Firmicutes Emb289P1bin52 Isolate Unclassified
86 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
87 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_069009 3300042612 Bacteria 6975
2 Ga0123355_10006992 3300009826 Bacteria 16813
3 Ga0123355_10007445 3300009826 Bacteria 16403
4 Ga0123355_10011203 3300009826 Bacteria 13803
5 Ga0123355_10073064 3300009826 Bacteria 5499
6 Ga0123355_10275442 3300009826 Bacteria 2331
7 Ga0123355_10366582 3300009826 Unclassified 1892
8 Ga0123355_10381819 3300009826 Unclassified 1835
9 Ga0123356_10064661 3300010049 Bacteria 3421
10 Ga0123354_10014243 3300010882 Bacteria 12383
11 Ga0123354_10182861 3300010882 Bacteria 2384
12 Ga0415639_001708 3300038395 Bacteria 25329
13 Ga0415639_002402 3300038395 Bacteria 6856
14 Ga0415639_073246 3300038395 Bacteria 5823
15 Ga0415639_114324 3300038395 Bacteria 1908
16 Ga0466693_114192 3300042592 Bacteria 1065
17 Ga0466693_336762 3300042592 Bacteria 1259
18 Ga0466699_203419 3300042597 Bacteria 1799
19 Ga0466699_437192 3300042597 Bacteria 1879
20 2227502412 2225789004 Bacteria 19092
21 JGI24698J34947_10000051 3300002449 Unclassified 34745
22 JGI24695J34938_10000007 3300002450 Bacteria 136740
23 JGI24695J34938_10011225 3300002450 Bacteria 4839
24 Ga0466712_048876 3300042614 Unclassified 2617
25 Ga0466718_026923 3300042617 Bacteria 5082
26 Ga0466718_031818 3300042617 Unclassified 4297
27 Ga0466726_052250 3300042619 Bacteria 3453
28 Ga0466706_135416 3300042599 Unclassified 11955
29 Ga0466706_234345 3300042599 Bacteria 7953
30 Ga0466717_298567 3300042604 Unclassified 8347
31 Ga0466720_038088 3300042607 Unclassified 30647
32 Ga0466722_233836 3300042609 Bacteria 14683
33 Ga0466732_208576 3300042656 Bacteria 2628
34 Ga0123355_10000625 3300009826 Bacteria 47838
35 Ga0123355_10013070 3300009826 Bacteria 12896
36 Ga0123355_10019916 3300009826 Unclassified 10691
37 Ga0123355_10075627 3300009826 Bacteria 5389
38 Ga0123355_10098052 3300009826 Bacteria 4624
39 Ga0123355_10115990 3300009826 Bacteria 4169
40 Ga0123355_10267898 3300009826 Bacteria 2379
41 Ga0123355_10363855 3300009826 Bacteria 1902
42 Ga0123355_10799837 3300009826 Bacteria 1052
43 Ga0123353_11167521 3300010167 Bacteria 1014
44 Ga0160466_100334 3300012809 Bacteria 28407
45 Ga0160470_100425 3300012813 Bacteria 19345
46 Ga0160441_100090 3300012825 Bacteria 110179
47 Ga0415639_012232 3300038395 Bacteria 33669
48 Ga0415639_029711 3300038395 Bacteria 5630
49 Ga0466694_031459 3300042594 Unclassified 1456
50 Ga0466694_256408 3300042594 Unclassified 11418
51 Ga0466696_395994 3300042596 Bacteria 11509
52 Ga0466699_017243 3300042597 Bacteria 1157
53 Ga0466699_167497 3300042597 Bacteria 2235
54 Ga0466699_200583 3300042597 Bacteria 3152
55 JGI24698J34947_10000186 3300002449 Archaea 24809
56 JGI24698J34947_10001112 3300002449 Unclassified 13882
57 JGI24698J34947_10002694 3300002449 Unclassified 9586
58 JGI24698J34947_10007526 3300002449 Bacteria 5984
59 JGI24695J34938_10001337 3300002450 Bacteria 21317
60 JGI24703J35330_11748528 3300002501 Bacteria 18666
61 JGI24703J35330_11748788 3300002501 Bacteria 36448
62 JGI24700J35501_10891123 3300002508 Bacteria 2693
63 Ga0072941_1295432 3300005201 Bacteria 3765
64 Ga0072941_1363222 3300005201 Bacteria 1420
65 Ga0466715_300349 3300042616 Bacteria 1575
66 Ga0466723_200749 3300042618 Bacteria 72306
67 Ga0466702_111456 3300042635 Unclassified 5388
68 Ga0466725_205709 3300042654 Bacteria 11895
69 Ga0466706_048473 3300042599 Bacteria 4644
70 Ga0466706_109638 3300042599 Bacteria 35665
71 Ga0466707_140550 3300042601 Bacteria 5919
72 Ga0466714_047126 3300042603 Bacteria 3829
73 Ga0466717_065595 3300042604 Bacteria 4674
74 Ga0466719_423598 3300042606 Bacteria 14743
75 Ga0466720_094068 3300042607 Unclassified 5052
76 Ga0123355_10000791 3300009826 Bacteria 43253
77 Ga0123355_10579017 3300009826 Bacteria 1343
78 Ga0123356_10249610 3300010049 Bacteria 1851
79 Ga0123353_10000522 3300010167 Unclassified 47481
80 Ga0123353_10091373 3300010167 Bacteria 4904
81 Ga0123353_10105792 3300010167 Bacteria 4534
82 Ga0123353_10108286 3300010167 Unclassified 4479
83 Ga0264413_105904 3300024493 Bacteria 53197
84 Ga0456237_0001449 3300041968 Bacteria 3771
85 Ga0466699_025018 3300042597 Unclassified 28767
86 Ga0466699_324297 3300042597 Bacteria 10358
87 Ga0466699_345338 3300042597 Bacteria 1536
88 2227557969 2225789004 Bacteria 2761
89 JGI24695J34938_10003803 3300002450 Bacteria 10268
90 JGI24702J35022_10001832 3300002462 Bacteria 13082
91 JGI24703J35330_11748812 3300002501 Bacteria 39815
92 JGI24700J35501_10928483 3300002508 Unclassified 7721
93 Ga0072941_1035887 3300005201 Bacteria 4752
94 Ga0466705_494529 3300042612 Unclassified 4368
95 Ga0466718_054878 3300042617 Unclassified 1522
96 Ga0466718_122934 3300042617 Bacteria 7643
97 Ga0466729_227362 3300042621 Bacteria 11989
98 Ga0466700_464416 3300042600 Bacteria 5928
99 Ga0466707_015340 3300042601 Bacteria 3611
100 Ga0466707_222156 3300042601 Unclassified 7118
101 Ga0466716_125719 3300042605 Bacteria 12234
102 Ga0466720_085131 3300042607 Bacteria 2012
103 Ga0466720_189459 3300042607 Bacteria 2181
104 Ga0466722_176210 3300042609 Bacteria 38896
105 Ga0466698_068383 3300042610 Bacteria 46034
106 Ga0466698_204064 3300042610 Bacteria 1407
107 Ga0466698_378497 3300042610 Bacteria 4222
108 Ga0123355_10000472 3300009826 Bacteria 53413
109 Ga0123355_10003300 3300009826 Unclassified 23082
110 Ga0123355_10047798 3300009826 Bacteria 6956
111 Ga0123355_10331928 3300009826 Unclassified 2036
112 Ga0123355_10478789 3300009826 Bacteria 1550
113 Ga0123355_10854975 3300009826 Bacteria 1000
114 Ga0123356_10078535 3300010049 Bacteria 3115
115 Ga0123353_10018081 3300010167 Bacteria 10403
116 Ga0123353_11167293 3300010167 Bacteria 1014
117 Ga0160464_100181 3300012805 Bacteria 65111
118 Ga0160445_101496 3300012847 Bacteria 6460
119 Ga0415639_020431 3300038395 Bacteria 33814
120 Ga0466690_009441 3300042590 Bacteria 8462
121 Ga0466694_064513 3300042594 Bacteria 20510
122 Ga0466699_174784 3300042597 Bacteria 2044
123 Ga0466699_372585 3300042597 Unclassified 7360
124 IMNBL1DRAFT_c0000199 3300000062 Bacteria 52581
125 JGI24698J34947_10000751 3300002449 Bacteria 15985
126 JGI24698J34947_10001793 3300002449 Bacteria 11445
127 JGI24703J35330_11746615 3300002501 Bacteria 5446
128 JGI24703J35330_11748566 3300002501 Bacteria 20226
129 Ga0072941_1023171 3300005201 Bacteria 3004
130 Ga0072941_1163824 3300005201 Bacteria 8961
131 Ga0466712_052092 3300042614 Bacteria 1013
132 Ga0466712_122044 3300042614 Unclassified 12018
133 Ga0466712_137939 3300042614 Unclassified 10562
134 Ga0466712_145054 3300042614 Bacteria 8353
135 Ga0466711_504776 3300042615 Bacteria 7904
136 Ga0466715_388582 3300042616 Bacteria 18317
137 Ga0466726_407052 3300042619 Bacteria 11757
138 Ga0466703_012296 3300042636 Bacteria 9544
139 Ga0466704_304200 3300042643 Bacteria 40117
140 Ga0466727_148960 3300042655 Bacteria 10842
141 Ga0466714_078331 3300042603 Unclassified 1469
142 Ga0466721_277606 3300042608 Bacteria 1461
143 Ga0123355_10002000 3300009826 Bacteria 28794
144 Ga0123355_10012495 3300009826 Bacteria 13155
145 Ga0123355_10078725 3300009826 Bacteria 5266
146 Ga0123355_10086615 3300009826 Bacteria 4981
147 Ga0123356_10003168 3300010049 Bacteria 17298
148 Ga0123356_10076072 3300010049 Bacteria 3163
149 Ga0123356_10336056 3300010049 Bacteria 1629
150 Ga0123353_10096764 3300010167 Bacteria 4757
151 Ga0123353_10452341 3300010167 Bacteria 1890
152 Ga0123353_10824961 3300010167 Bacteria 1276
153 Ga0160441_100079 3300012825 Bacteria 120437
154 Ga0160467_100143 3300012829 Bacteria 101006
155 Ga0415639_002401 3300038395 Bacteria 12890
156 Ga0415639_021282 3300038395 Unclassified 7534
157 Ga0415639_037708 3300038395 Bacteria 8877
158 Ga0415639_166223 3300038395 Bacteria 2072
159 Ga0415639_211269 3300038395 Bacteria 1315
160 Ga0466692_037117 3300042591 Bacteria 26903
161 Ga0466693_428905 3300042592 Bacteria 1648
162 Ga0466699_039414 3300042597 Bacteria 3004
163 JGI24695J34938_10000212 3300002450 Bacteria 55353
164 JGI24703J35330_11684918 3300002501 Bacteria 1846
165 JGI24703J35330_11748120 3300002501 Bacteria 10897
166 Ga0072940_1001077 3300005200 Bacteria 16046
167 Ga0072941_1015246 3300005201 Bacteria 51048
168 Ga0072941_1031296 3300005201 Bacteria 58559
169 Ga0072941_1119869 3300005201 Bacteria 6916
170 Ga0466705_460630 3300042612 Archaea 13331
171 Ga0466712_014886 3300042614 Unclassified 1451
172 Ga0466712_097717 3300042614 Bacteria 2562
173 Ga0466712_132364 3300042614 Bacteria 18490
174 Ga0466726_184927 3300042619 Unclassified 11009
175 Ga0466703_130211 3300042636 Bacteria 1465
176 Ga0466714_075323 3300042603 Bacteria 15379
177 Ga0466732_245537 3300042656 Bacteria 7176
178 Ga0466732_430441 3300042656 Bacteria 16496
179 Ga0123355_10001510 3300009826 Bacteria 32449
180 Ga0123355_10002717 3300009826 Bacteria 25074
181 Ga0123355_10019048 3300009826 Bacteria 10919
182 Ga0123355_10072488 3300009826 Bacteria 5524
183 Ga0123355_10155426 3300009826 Bacteria 3462
184 Ga0123355_10524233 3300009826 Unclassified 1448
185 Ga0123355_10639405 3300009826 Bacteria 1246
186 Ga0123355_10701623 3300009826 Bacteria 1162
187 Ga0123356_10114763 3300010049 Bacteria 2609
188 Ga0123356_10365688 3300010049 Bacteria 1571
189 Ga0123353_10000185 3300010167 Bacteria 79384
190 Ga0123354_10217226 3300010882 Bacteria 2044
191 Ga0264413_134431 3300024493 Bacteria 2368
192 Ga0415639_018965 3300038395 Bacteria 7525
193 Ga0415639_030959 3300038395 Bacteria 9985
194 Ga0415639_078321 3300038395 Bacteria 3115
195 Ga0415639_115579 3300038395 Unclassified 1542
196 Ga0415639_136465 3300038395 Bacteria 4723
197 Ga0466694_065842 3300042594 Bacteria 35703
198 Ga0466699_218416 3300042597 Bacteria 26986
199 IMNBL1DRAFT_c0003533 3300000062 Bacteria 9967
200 JGI24698J34947_10004023 3300002449 Bacteria 7991
201 JGI24698J34947_10026501 3300002449 Unclassified 3080
202 JGI24698J34947_10028111 3300002449 Bacteria 2979
203 JGI24698J34947_10107127 3300002449 Unclassified 1241
204 JGI24695J34938_10000314 3300002450 Bacteria 47830
205 JGI24703J35330_11748763 3300002501 Bacteria 32446
206 Ga0466723_144650 3300042618 Bacteria 15178
207 Ga0466726_165779 3300042619 Bacteria 14830
208 Ga0466727_125714 3300042655 Bacteria 6341
209 Ga0466706_252128 3300042599 Unclassified 6452
210 Ga0466714_001154 3300042603 Bacteria 1779
211 Ga0466714_006278 3300042603 Bacteria 2513
212 Ga0466714_038902 3300042603 Bacteria 7488
213 Ga0466717_031033 3300042604 Bacteria 8015
214 Ga0466698_012297 3300042610 Bacteria 1905
215 Ga0466698_481086 3300042610 Bacteria 1066
216 Ga0123355_10006757 3300009826 Bacteria 17073
217 Ga0123355_10007533 3300009826 Bacteria 16334
218 Ga0123355_10014440 3300009826 Bacteria 12357
219 Ga0123355_10379848 3300009826 Bacteria 1842
220 Ga0123355_10472945 3300009826 Bacteria 1565
221 Ga0123355_10484290 3300009826 Bacteria 1537
222 Ga0123355_10544941 3300009826 Bacteria 1406
223 Ga0123356_10009982 3300010049 Bacteria 9348
224 Ga0123356_10016324 3300010049 Bacteria 7090
225 Ga0123353_10334711 3300010167 Bacteria 2289
226 Ga0123353_10373136 3300010167 Bacteria 2138
227 Ga0415639_003998 3300038395 Unclassified 2000
228 Ga0415639_006952 3300038395 Bacteria 47782
229 Ga0415639_019917 3300038395 Bacteria 23057
230 Ga0415639_116338 3300038395 Bacteria 6842
231 Ga0415639_142256 3300038395 Bacteria 2488
232 Ga0466692_031934 3300042591 Bacteria 29085
233 Ga0466691_050768 3300042593 Bacteria 73218
234 Ga0466694_271482 3300042594 Unclassified 1584
235 Ga0466699_185768 3300042597 Bacteria 1582
236 IMNBL1DRAFT_c0000170 3300000062 Bacteria 58504
237 IMNBL1DRAFT_c0001249 3300000062 Bacteria 19187
238 JGI24698J34947_10023581 3300002449 Unclassified 3291
239 JGI24695J34938_10004427 3300002450 Bacteria 9218
240 JGI24700J35501_10930233 3300002508 Bacteria 12313
241 Ga0466712_189305 3300042614 Unclassified 10369
242 Ga0466729_080037 3300042621 Bacteria 2085
243 Ga0466702_460670 3300042635 Bacteria 1982
244 Ga0466708_196078 3300042652 Bacteria 11603
245 Ga0466700_171899 3300042600 Bacteria 1078
246 Ga0466714_028521 3300042603 Bacteria 38215
247 Ga0466714_136007 3300042603 Bacteria 4515
248 Ga0466714_151995 3300042603 Bacteria 2202
249 Ga0466720_186881 3300042607 Unclassified 19399
250 Ga0466722_114421 3300042609 Bacteria 17645
251 Ga0466722_136943 3300042609 Bacteria 7059
252 Ga0466698_099426 3300042610 Bacteria 2190
253 Ga0123355_10000046 3300009826 Bacteria 122862
254 Ga0123355_10082324 3300009826 Bacteria 5134
255 Ga0123355_10277779 3300009826 Bacteria 2317
256 Ga0123355_10540735 3300009826 Bacteria 1414
257 Ga0123356_10037965 3300010049 Bacteria 4490
258 Ga0123356_10636457 3300010049 Bacteria 1233
259 Ga0123353_10000039 3300010167 Bacteria 140682
260 Ga0123353_10071132 3300010167 Bacteria 5589
261 Ga0123353_10231342 3300010167 Bacteria 2881
262 Ga0160465_100881 3300012803 Bacteria 10619
263 Ga0160464_100244 3300012805 Bacteria 52553
264 Ga0160452_100156 3300012834 Bacteria 80068
265 Ga0160455_101262 3300012837 Bacteria 8255
266 Ga0415639_001522 3300038395 Bacteria 37166
267 Ga0415639_003986 3300038395 Unclassified 5984
268 Ga0415639_012513 3300038395 Bacteria 1977
269 Ga0415639_043372 3300038395 Bacteria 3699
270 Ga0415639_157049 3300038395 Bacteria 4345
271 Ga0466690_261120 3300042590 Bacteria 17769
272 Ga0466692_015361 3300042591 Bacteria 56574
273 Ga0466699_010060 3300042597 Viruses 10027
274 JGI24703J35330_11725499 3300002501 Bacteria 2522
275 Ga0068305_10596583 3300005083 Bacteria 5337
276 Ga0466712_063754 3300042614 Bacteria 21748
277 Ga0466712_291615 3300042614 Unclassified 1058
278 Ga0466715_120385 3300042616 Bacteria 32691
279 Ga0466729_283479 3300042621 Bacteria 8952
280 Ga0466706_158778 3300042599 Bacteria 62402
281 Ga0466706_181893 3300042599 Unclassified 5325
282 Ga0466706_204451 3300042599 Bacteria 2252
283 Ga0466714_016541 3300042603 Bacteria 13683
284 Ga0466717_257708 3300042604 Bacteria 1524
285 Ga0466717_286555 3300042604 Bacteria 9356
286 Ga0466719_123098 3300042606 Bacteria 142874
287 Ga0466720_087401 3300042607 Bacteria 2173

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component 119 318 0.78

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.