Protein Family IF04976
Metagenome
Isolate
325
Members
87
Samples
287
Scaffolds
301.94
Avg Length
Representative Sequence
- ID
- 3300042594|Ga0466694_064513|Ga0466694_064513_17170_18168
- Length
- 332 aa
- Sequence
- MIRKEKYLILHNGLFSMNTPLNSLCHIDTNMLKKRRTIMAADGLHALALLLPYGVLFSMFIAVPIAVAIYLSFTYFDLVQAPVFAGLYNYVTLLTQDTVFFKNVLPNTILFALIVGPGGYMISFLMAWMLSQIQPAPRTLLALLLYMPSLAGGVFISVLWRTIFSGNQSGYINAVLLRWNLIQTPIQFLQSPDFLMSIMILVSLWSAMGIGFLAMLAGILNINEELYEAAYIDGLRNRFQEIIYITIPSMKPQMLFGAVMAIVGAFNNGAIGVALSGANPTPQYSGQLITNHIDDYGFLRYEMGYAAAVSVALLCIVWVFSKLAYTFFGERD
Sample Types
Isolate
11.4%
Metagenome
88.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
32.9%
Unclassified
29.1%
Kalotermitidae
15.2%
Rhinotermitidae
5.1%
Blattidae
3.8%
Armadillidiidae
3.8%
Scarabaeidae
2.5%
Passalidae
2.5%
Termopsidae
2.5%
Culicidae
1.3%
Hodotermitidae
1.3%
Taxonomy
Archaea
2
Bacteria
278
Eukaryota
0
Viruses
1
Unclassified
44
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940425923 | Paenibacillus sp. PastH-4 | Isolate | Blattidae |
| 2 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 3 | 2820541116 | Unclassified Firmicutes Lab288P1bin109 | Isolate | Unclassified |
| 4 | 2820581541 | Unclassified Firmicutes Emb289P3bin127 | Isolate | Unclassified |
| 5 | 2820654856 | Unclassified Firmicutes Cu122P1bin2 | Isolate | Unclassified |
| 6 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 7 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 8 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 9 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 10 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 11 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 12 | 2820298281 | Unclassified Firmicutes Th196P1bin9 | Isolate | Unclassified |
| 13 | 2820442516 | Unclassified Firmicutes Lab288P3bin200 | Isolate | Unclassified |
| 14 | 2820696217 | Unclassified Firmicutes Co191P1bin66 | Isolate | Unclassified |
| 15 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 16 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 17 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 18 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 19 | 8018794549 | Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 | Isolate | |
| 20 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 21 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 22 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 23 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 24 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 25 | 2820385248 | Unclassified Firmicutes Nt197P1bin19 | Isolate | Unclassified |
| 26 | 2820676843 | Unclassified Firmicutes Co191P3bin17 | Isolate | Unclassified |
| 27 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 28 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 29 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 30 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 31 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 32 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 33 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 34 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 35 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 36 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 37 | 2852337885 | Paenibacillus protaetiae FW100M-2 | Isolate | Scarabaeidae |
| 38 | 2940413413 | Paenibacillus sp. PastH-3 | Isolate | Blattidae |
| 39 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 40 | 2820257794 | Unclassified Firmicutes Th196P3bin47 | Isolate | Unclassified |
| 41 | 2820329821 | Unclassified Firmicutes Nt197P3bin77 | Isolate | Unclassified |
| 42 | 2820378768 | Unclassified Firmicutes Nt197P1bin7 | Isolate | Unclassified |
| 43 | 2820627938 | Unclassified Firmicutes Emb289P1bin122 | Isolate | Unclassified |
| 44 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 45 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 46 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 47 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 48 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 49 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 50 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 51 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 52 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 53 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 54 | 2940419646 | Paenibacillus sp. PastF-4 | Isolate | Blattidae |
| 55 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 56 | 2820306284 | Unclassified Firmicutes Th196P1bin11 | Isolate | Unclassified |
| 57 | 2820405014 | Unclassified Firmicutes Lab288P4bin88 | Isolate | Unclassified |
| 58 | 2820435670 | Unclassified Firmicutes Lab288P3bin217 | Isolate | Unclassified |
| 59 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 60 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 61 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 62 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 63 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 64 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 65 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 66 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 67 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 68 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 69 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 70 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 71 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 72 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 73 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 74 | 2576861701 | Paenibacillus sp. JCM 10914 | Isolate | Termitidae |
| 75 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 76 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 77 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 78 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 79 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 80 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 81 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 82 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 83 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 84 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 85 | 2820600392 | Unclassified Firmicutes Emb289P1bin52 | Isolate | Unclassified |
| 86 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 87 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_069009 | 3300042612 | Bacteria | 6975 |
| 2 | Ga0123355_10006992 | 3300009826 | Bacteria | 16813 |
| 3 | Ga0123355_10007445 | 3300009826 | Bacteria | 16403 |
| 4 | Ga0123355_10011203 | 3300009826 | Bacteria | 13803 |
| 5 | Ga0123355_10073064 | 3300009826 | Bacteria | 5499 |
| 6 | Ga0123355_10275442 | 3300009826 | Bacteria | 2331 |
| 7 | Ga0123355_10366582 | 3300009826 | Unclassified | 1892 |
| 8 | Ga0123355_10381819 | 3300009826 | Unclassified | 1835 |
| 9 | Ga0123356_10064661 | 3300010049 | Bacteria | 3421 |
| 10 | Ga0123354_10014243 | 3300010882 | Bacteria | 12383 |
| 11 | Ga0123354_10182861 | 3300010882 | Bacteria | 2384 |
| 12 | Ga0415639_001708 | 3300038395 | Bacteria | 25329 |
| 13 | Ga0415639_002402 | 3300038395 | Bacteria | 6856 |
| 14 | Ga0415639_073246 | 3300038395 | Bacteria | 5823 |
| 15 | Ga0415639_114324 | 3300038395 | Bacteria | 1908 |
| 16 | Ga0466693_114192 | 3300042592 | Bacteria | 1065 |
| 17 | Ga0466693_336762 | 3300042592 | Bacteria | 1259 |
| 18 | Ga0466699_203419 | 3300042597 | Bacteria | 1799 |
| 19 | Ga0466699_437192 | 3300042597 | Bacteria | 1879 |
| 20 | 2227502412 | 2225789004 | Bacteria | 19092 |
| 21 | JGI24698J34947_10000051 | 3300002449 | Unclassified | 34745 |
| 22 | JGI24695J34938_10000007 | 3300002450 | Bacteria | 136740 |
| 23 | JGI24695J34938_10011225 | 3300002450 | Bacteria | 4839 |
| 24 | Ga0466712_048876 | 3300042614 | Unclassified | 2617 |
| 25 | Ga0466718_026923 | 3300042617 | Bacteria | 5082 |
| 26 | Ga0466718_031818 | 3300042617 | Unclassified | 4297 |
| 27 | Ga0466726_052250 | 3300042619 | Bacteria | 3453 |
| 28 | Ga0466706_135416 | 3300042599 | Unclassified | 11955 |
| 29 | Ga0466706_234345 | 3300042599 | Bacteria | 7953 |
| 30 | Ga0466717_298567 | 3300042604 | Unclassified | 8347 |
| 31 | Ga0466720_038088 | 3300042607 | Unclassified | 30647 |
| 32 | Ga0466722_233836 | 3300042609 | Bacteria | 14683 |
| 33 | Ga0466732_208576 | 3300042656 | Bacteria | 2628 |
| 34 | Ga0123355_10000625 | 3300009826 | Bacteria | 47838 |
| 35 | Ga0123355_10013070 | 3300009826 | Bacteria | 12896 |
| 36 | Ga0123355_10019916 | 3300009826 | Unclassified | 10691 |
| 37 | Ga0123355_10075627 | 3300009826 | Bacteria | 5389 |
| 38 | Ga0123355_10098052 | 3300009826 | Bacteria | 4624 |
| 39 | Ga0123355_10115990 | 3300009826 | Bacteria | 4169 |
| 40 | Ga0123355_10267898 | 3300009826 | Bacteria | 2379 |
| 41 | Ga0123355_10363855 | 3300009826 | Bacteria | 1902 |
| 42 | Ga0123355_10799837 | 3300009826 | Bacteria | 1052 |
| 43 | Ga0123353_11167521 | 3300010167 | Bacteria | 1014 |
| 44 | Ga0160466_100334 | 3300012809 | Bacteria | 28407 |
| 45 | Ga0160470_100425 | 3300012813 | Bacteria | 19345 |
| 46 | Ga0160441_100090 | 3300012825 | Bacteria | 110179 |
| 47 | Ga0415639_012232 | 3300038395 | Bacteria | 33669 |
| 48 | Ga0415639_029711 | 3300038395 | Bacteria | 5630 |
| 49 | Ga0466694_031459 | 3300042594 | Unclassified | 1456 |
| 50 | Ga0466694_256408 | 3300042594 | Unclassified | 11418 |
| 51 | Ga0466696_395994 | 3300042596 | Bacteria | 11509 |
| 52 | Ga0466699_017243 | 3300042597 | Bacteria | 1157 |
| 53 | Ga0466699_167497 | 3300042597 | Bacteria | 2235 |
| 54 | Ga0466699_200583 | 3300042597 | Bacteria | 3152 |
| 55 | JGI24698J34947_10000186 | 3300002449 | Archaea | 24809 |
| 56 | JGI24698J34947_10001112 | 3300002449 | Unclassified | 13882 |
| 57 | JGI24698J34947_10002694 | 3300002449 | Unclassified | 9586 |
| 58 | JGI24698J34947_10007526 | 3300002449 | Bacteria | 5984 |
| 59 | JGI24695J34938_10001337 | 3300002450 | Bacteria | 21317 |
| 60 | JGI24703J35330_11748528 | 3300002501 | Bacteria | 18666 |
| 61 | JGI24703J35330_11748788 | 3300002501 | Bacteria | 36448 |
| 62 | JGI24700J35501_10891123 | 3300002508 | Bacteria | 2693 |
| 63 | Ga0072941_1295432 | 3300005201 | Bacteria | 3765 |
| 64 | Ga0072941_1363222 | 3300005201 | Bacteria | 1420 |
| 65 | Ga0466715_300349 | 3300042616 | Bacteria | 1575 |
| 66 | Ga0466723_200749 | 3300042618 | Bacteria | 72306 |
| 67 | Ga0466702_111456 | 3300042635 | Unclassified | 5388 |
| 68 | Ga0466725_205709 | 3300042654 | Bacteria | 11895 |
| 69 | Ga0466706_048473 | 3300042599 | Bacteria | 4644 |
| 70 | Ga0466706_109638 | 3300042599 | Bacteria | 35665 |
| 71 | Ga0466707_140550 | 3300042601 | Bacteria | 5919 |
| 72 | Ga0466714_047126 | 3300042603 | Bacteria | 3829 |
| 73 | Ga0466717_065595 | 3300042604 | Bacteria | 4674 |
| 74 | Ga0466719_423598 | 3300042606 | Bacteria | 14743 |
| 75 | Ga0466720_094068 | 3300042607 | Unclassified | 5052 |
| 76 | Ga0123355_10000791 | 3300009826 | Bacteria | 43253 |
| 77 | Ga0123355_10579017 | 3300009826 | Bacteria | 1343 |
| 78 | Ga0123356_10249610 | 3300010049 | Bacteria | 1851 |
| 79 | Ga0123353_10000522 | 3300010167 | Unclassified | 47481 |
| 80 | Ga0123353_10091373 | 3300010167 | Bacteria | 4904 |
| 81 | Ga0123353_10105792 | 3300010167 | Bacteria | 4534 |
| 82 | Ga0123353_10108286 | 3300010167 | Unclassified | 4479 |
| 83 | Ga0264413_105904 | 3300024493 | Bacteria | 53197 |
| 84 | Ga0456237_0001449 | 3300041968 | Bacteria | 3771 |
| 85 | Ga0466699_025018 | 3300042597 | Unclassified | 28767 |
| 86 | Ga0466699_324297 | 3300042597 | Bacteria | 10358 |
| 87 | Ga0466699_345338 | 3300042597 | Bacteria | 1536 |
| 88 | 2227557969 | 2225789004 | Bacteria | 2761 |
| 89 | JGI24695J34938_10003803 | 3300002450 | Bacteria | 10268 |
| 90 | JGI24702J35022_10001832 | 3300002462 | Bacteria | 13082 |
| 91 | JGI24703J35330_11748812 | 3300002501 | Bacteria | 39815 |
| 92 | JGI24700J35501_10928483 | 3300002508 | Unclassified | 7721 |
| 93 | Ga0072941_1035887 | 3300005201 | Bacteria | 4752 |
| 94 | Ga0466705_494529 | 3300042612 | Unclassified | 4368 |
| 95 | Ga0466718_054878 | 3300042617 | Unclassified | 1522 |
| 96 | Ga0466718_122934 | 3300042617 | Bacteria | 7643 |
| 97 | Ga0466729_227362 | 3300042621 | Bacteria | 11989 |
| 98 | Ga0466700_464416 | 3300042600 | Bacteria | 5928 |
| 99 | Ga0466707_015340 | 3300042601 | Bacteria | 3611 |
| 100 | Ga0466707_222156 | 3300042601 | Unclassified | 7118 |
| 101 | Ga0466716_125719 | 3300042605 | Bacteria | 12234 |
| 102 | Ga0466720_085131 | 3300042607 | Bacteria | 2012 |
| 103 | Ga0466720_189459 | 3300042607 | Bacteria | 2181 |
| 104 | Ga0466722_176210 | 3300042609 | Bacteria | 38896 |
| 105 | Ga0466698_068383 | 3300042610 | Bacteria | 46034 |
| 106 | Ga0466698_204064 | 3300042610 | Bacteria | 1407 |
| 107 | Ga0466698_378497 | 3300042610 | Bacteria | 4222 |
| 108 | Ga0123355_10000472 | 3300009826 | Bacteria | 53413 |
| 109 | Ga0123355_10003300 | 3300009826 | Unclassified | 23082 |
| 110 | Ga0123355_10047798 | 3300009826 | Bacteria | 6956 |
| 111 | Ga0123355_10331928 | 3300009826 | Unclassified | 2036 |
| 112 | Ga0123355_10478789 | 3300009826 | Bacteria | 1550 |
| 113 | Ga0123355_10854975 | 3300009826 | Bacteria | 1000 |
| 114 | Ga0123356_10078535 | 3300010049 | Bacteria | 3115 |
| 115 | Ga0123353_10018081 | 3300010167 | Bacteria | 10403 |
| 116 | Ga0123353_11167293 | 3300010167 | Bacteria | 1014 |
| 117 | Ga0160464_100181 | 3300012805 | Bacteria | 65111 |
| 118 | Ga0160445_101496 | 3300012847 | Bacteria | 6460 |
| 119 | Ga0415639_020431 | 3300038395 | Bacteria | 33814 |
| 120 | Ga0466690_009441 | 3300042590 | Bacteria | 8462 |
| 121 | Ga0466694_064513 | 3300042594 | Bacteria | 20510 |
| 122 | Ga0466699_174784 | 3300042597 | Bacteria | 2044 |
| 123 | Ga0466699_372585 | 3300042597 | Unclassified | 7360 |
| 124 | IMNBL1DRAFT_c0000199 | 3300000062 | Bacteria | 52581 |
| 125 | JGI24698J34947_10000751 | 3300002449 | Bacteria | 15985 |
| 126 | JGI24698J34947_10001793 | 3300002449 | Bacteria | 11445 |
| 127 | JGI24703J35330_11746615 | 3300002501 | Bacteria | 5446 |
| 128 | JGI24703J35330_11748566 | 3300002501 | Bacteria | 20226 |
| 129 | Ga0072941_1023171 | 3300005201 | Bacteria | 3004 |
| 130 | Ga0072941_1163824 | 3300005201 | Bacteria | 8961 |
| 131 | Ga0466712_052092 | 3300042614 | Bacteria | 1013 |
| 132 | Ga0466712_122044 | 3300042614 | Unclassified | 12018 |
| 133 | Ga0466712_137939 | 3300042614 | Unclassified | 10562 |
| 134 | Ga0466712_145054 | 3300042614 | Bacteria | 8353 |
| 135 | Ga0466711_504776 | 3300042615 | Bacteria | 7904 |
| 136 | Ga0466715_388582 | 3300042616 | Bacteria | 18317 |
| 137 | Ga0466726_407052 | 3300042619 | Bacteria | 11757 |
| 138 | Ga0466703_012296 | 3300042636 | Bacteria | 9544 |
| 139 | Ga0466704_304200 | 3300042643 | Bacteria | 40117 |
| 140 | Ga0466727_148960 | 3300042655 | Bacteria | 10842 |
| 141 | Ga0466714_078331 | 3300042603 | Unclassified | 1469 |
| 142 | Ga0466721_277606 | 3300042608 | Bacteria | 1461 |
| 143 | Ga0123355_10002000 | 3300009826 | Bacteria | 28794 |
| 144 | Ga0123355_10012495 | 3300009826 | Bacteria | 13155 |
| 145 | Ga0123355_10078725 | 3300009826 | Bacteria | 5266 |
| 146 | Ga0123355_10086615 | 3300009826 | Bacteria | 4981 |
| 147 | Ga0123356_10003168 | 3300010049 | Bacteria | 17298 |
| 148 | Ga0123356_10076072 | 3300010049 | Bacteria | 3163 |
| 149 | Ga0123356_10336056 | 3300010049 | Bacteria | 1629 |
| 150 | Ga0123353_10096764 | 3300010167 | Bacteria | 4757 |
| 151 | Ga0123353_10452341 | 3300010167 | Bacteria | 1890 |
| 152 | Ga0123353_10824961 | 3300010167 | Bacteria | 1276 |
| 153 | Ga0160441_100079 | 3300012825 | Bacteria | 120437 |
| 154 | Ga0160467_100143 | 3300012829 | Bacteria | 101006 |
| 155 | Ga0415639_002401 | 3300038395 | Bacteria | 12890 |
| 156 | Ga0415639_021282 | 3300038395 | Unclassified | 7534 |
| 157 | Ga0415639_037708 | 3300038395 | Bacteria | 8877 |
| 158 | Ga0415639_166223 | 3300038395 | Bacteria | 2072 |
| 159 | Ga0415639_211269 | 3300038395 | Bacteria | 1315 |
| 160 | Ga0466692_037117 | 3300042591 | Bacteria | 26903 |
| 161 | Ga0466693_428905 | 3300042592 | Bacteria | 1648 |
| 162 | Ga0466699_039414 | 3300042597 | Bacteria | 3004 |
| 163 | JGI24695J34938_10000212 | 3300002450 | Bacteria | 55353 |
| 164 | JGI24703J35330_11684918 | 3300002501 | Bacteria | 1846 |
| 165 | JGI24703J35330_11748120 | 3300002501 | Bacteria | 10897 |
| 166 | Ga0072940_1001077 | 3300005200 | Bacteria | 16046 |
| 167 | Ga0072941_1015246 | 3300005201 | Bacteria | 51048 |
| 168 | Ga0072941_1031296 | 3300005201 | Bacteria | 58559 |
| 169 | Ga0072941_1119869 | 3300005201 | Bacteria | 6916 |
| 170 | Ga0466705_460630 | 3300042612 | Archaea | 13331 |
| 171 | Ga0466712_014886 | 3300042614 | Unclassified | 1451 |
| 172 | Ga0466712_097717 | 3300042614 | Bacteria | 2562 |
| 173 | Ga0466712_132364 | 3300042614 | Bacteria | 18490 |
| 174 | Ga0466726_184927 | 3300042619 | Unclassified | 11009 |
| 175 | Ga0466703_130211 | 3300042636 | Bacteria | 1465 |
| 176 | Ga0466714_075323 | 3300042603 | Bacteria | 15379 |
| 177 | Ga0466732_245537 | 3300042656 | Bacteria | 7176 |
| 178 | Ga0466732_430441 | 3300042656 | Bacteria | 16496 |
| 179 | Ga0123355_10001510 | 3300009826 | Bacteria | 32449 |
| 180 | Ga0123355_10002717 | 3300009826 | Bacteria | 25074 |
| 181 | Ga0123355_10019048 | 3300009826 | Bacteria | 10919 |
| 182 | Ga0123355_10072488 | 3300009826 | Bacteria | 5524 |
| 183 | Ga0123355_10155426 | 3300009826 | Bacteria | 3462 |
| 184 | Ga0123355_10524233 | 3300009826 | Unclassified | 1448 |
| 185 | Ga0123355_10639405 | 3300009826 | Bacteria | 1246 |
| 186 | Ga0123355_10701623 | 3300009826 | Bacteria | 1162 |
| 187 | Ga0123356_10114763 | 3300010049 | Bacteria | 2609 |
| 188 | Ga0123356_10365688 | 3300010049 | Bacteria | 1571 |
| 189 | Ga0123353_10000185 | 3300010167 | Bacteria | 79384 |
| 190 | Ga0123354_10217226 | 3300010882 | Bacteria | 2044 |
| 191 | Ga0264413_134431 | 3300024493 | Bacteria | 2368 |
| 192 | Ga0415639_018965 | 3300038395 | Bacteria | 7525 |
| 193 | Ga0415639_030959 | 3300038395 | Bacteria | 9985 |
| 194 | Ga0415639_078321 | 3300038395 | Bacteria | 3115 |
| 195 | Ga0415639_115579 | 3300038395 | Unclassified | 1542 |
| 196 | Ga0415639_136465 | 3300038395 | Bacteria | 4723 |
| 197 | Ga0466694_065842 | 3300042594 | Bacteria | 35703 |
| 198 | Ga0466699_218416 | 3300042597 | Bacteria | 26986 |
| 199 | IMNBL1DRAFT_c0003533 | 3300000062 | Bacteria | 9967 |
| 200 | JGI24698J34947_10004023 | 3300002449 | Bacteria | 7991 |
| 201 | JGI24698J34947_10026501 | 3300002449 | Unclassified | 3080 |
| 202 | JGI24698J34947_10028111 | 3300002449 | Bacteria | 2979 |
| 203 | JGI24698J34947_10107127 | 3300002449 | Unclassified | 1241 |
| 204 | JGI24695J34938_10000314 | 3300002450 | Bacteria | 47830 |
| 205 | JGI24703J35330_11748763 | 3300002501 | Bacteria | 32446 |
| 206 | Ga0466723_144650 | 3300042618 | Bacteria | 15178 |
| 207 | Ga0466726_165779 | 3300042619 | Bacteria | 14830 |
| 208 | Ga0466727_125714 | 3300042655 | Bacteria | 6341 |
| 209 | Ga0466706_252128 | 3300042599 | Unclassified | 6452 |
| 210 | Ga0466714_001154 | 3300042603 | Bacteria | 1779 |
| 211 | Ga0466714_006278 | 3300042603 | Bacteria | 2513 |
| 212 | Ga0466714_038902 | 3300042603 | Bacteria | 7488 |
| 213 | Ga0466717_031033 | 3300042604 | Bacteria | 8015 |
| 214 | Ga0466698_012297 | 3300042610 | Bacteria | 1905 |
| 215 | Ga0466698_481086 | 3300042610 | Bacteria | 1066 |
| 216 | Ga0123355_10006757 | 3300009826 | Bacteria | 17073 |
| 217 | Ga0123355_10007533 | 3300009826 | Bacteria | 16334 |
| 218 | Ga0123355_10014440 | 3300009826 | Bacteria | 12357 |
| 219 | Ga0123355_10379848 | 3300009826 | Bacteria | 1842 |
| 220 | Ga0123355_10472945 | 3300009826 | Bacteria | 1565 |
| 221 | Ga0123355_10484290 | 3300009826 | Bacteria | 1537 |
| 222 | Ga0123355_10544941 | 3300009826 | Bacteria | 1406 |
| 223 | Ga0123356_10009982 | 3300010049 | Bacteria | 9348 |
| 224 | Ga0123356_10016324 | 3300010049 | Bacteria | 7090 |
| 225 | Ga0123353_10334711 | 3300010167 | Bacteria | 2289 |
| 226 | Ga0123353_10373136 | 3300010167 | Bacteria | 2138 |
| 227 | Ga0415639_003998 | 3300038395 | Unclassified | 2000 |
| 228 | Ga0415639_006952 | 3300038395 | Bacteria | 47782 |
| 229 | Ga0415639_019917 | 3300038395 | Bacteria | 23057 |
| 230 | Ga0415639_116338 | 3300038395 | Bacteria | 6842 |
| 231 | Ga0415639_142256 | 3300038395 | Bacteria | 2488 |
| 232 | Ga0466692_031934 | 3300042591 | Bacteria | 29085 |
| 233 | Ga0466691_050768 | 3300042593 | Bacteria | 73218 |
| 234 | Ga0466694_271482 | 3300042594 | Unclassified | 1584 |
| 235 | Ga0466699_185768 | 3300042597 | Bacteria | 1582 |
| 236 | IMNBL1DRAFT_c0000170 | 3300000062 | Bacteria | 58504 |
| 237 | IMNBL1DRAFT_c0001249 | 3300000062 | Bacteria | 19187 |
| 238 | JGI24698J34947_10023581 | 3300002449 | Unclassified | 3291 |
| 239 | JGI24695J34938_10004427 | 3300002450 | Bacteria | 9218 |
| 240 | JGI24700J35501_10930233 | 3300002508 | Bacteria | 12313 |
| 241 | Ga0466712_189305 | 3300042614 | Unclassified | 10369 |
| 242 | Ga0466729_080037 | 3300042621 | Bacteria | 2085 |
| 243 | Ga0466702_460670 | 3300042635 | Bacteria | 1982 |
| 244 | Ga0466708_196078 | 3300042652 | Bacteria | 11603 |
| 245 | Ga0466700_171899 | 3300042600 | Bacteria | 1078 |
| 246 | Ga0466714_028521 | 3300042603 | Bacteria | 38215 |
| 247 | Ga0466714_136007 | 3300042603 | Bacteria | 4515 |
| 248 | Ga0466714_151995 | 3300042603 | Bacteria | 2202 |
| 249 | Ga0466720_186881 | 3300042607 | Unclassified | 19399 |
| 250 | Ga0466722_114421 | 3300042609 | Bacteria | 17645 |
| 251 | Ga0466722_136943 | 3300042609 | Bacteria | 7059 |
| 252 | Ga0466698_099426 | 3300042610 | Bacteria | 2190 |
| 253 | Ga0123355_10000046 | 3300009826 | Bacteria | 122862 |
| 254 | Ga0123355_10082324 | 3300009826 | Bacteria | 5134 |
| 255 | Ga0123355_10277779 | 3300009826 | Bacteria | 2317 |
| 256 | Ga0123355_10540735 | 3300009826 | Bacteria | 1414 |
| 257 | Ga0123356_10037965 | 3300010049 | Bacteria | 4490 |
| 258 | Ga0123356_10636457 | 3300010049 | Bacteria | 1233 |
| 259 | Ga0123353_10000039 | 3300010167 | Bacteria | 140682 |
| 260 | Ga0123353_10071132 | 3300010167 | Bacteria | 5589 |
| 261 | Ga0123353_10231342 | 3300010167 | Bacteria | 2881 |
| 262 | Ga0160465_100881 | 3300012803 | Bacteria | 10619 |
| 263 | Ga0160464_100244 | 3300012805 | Bacteria | 52553 |
| 264 | Ga0160452_100156 | 3300012834 | Bacteria | 80068 |
| 265 | Ga0160455_101262 | 3300012837 | Bacteria | 8255 |
| 266 | Ga0415639_001522 | 3300038395 | Bacteria | 37166 |
| 267 | Ga0415639_003986 | 3300038395 | Unclassified | 5984 |
| 268 | Ga0415639_012513 | 3300038395 | Bacteria | 1977 |
| 269 | Ga0415639_043372 | 3300038395 | Bacteria | 3699 |
| 270 | Ga0415639_157049 | 3300038395 | Bacteria | 4345 |
| 271 | Ga0466690_261120 | 3300042590 | Bacteria | 17769 |
| 272 | Ga0466692_015361 | 3300042591 | Bacteria | 56574 |
| 273 | Ga0466699_010060 | 3300042597 | Viruses | 10027 |
| 274 | JGI24703J35330_11725499 | 3300002501 | Bacteria | 2522 |
| 275 | Ga0068305_10596583 | 3300005083 | Bacteria | 5337 |
| 276 | Ga0466712_063754 | 3300042614 | Bacteria | 21748 |
| 277 | Ga0466712_291615 | 3300042614 | Unclassified | 1058 |
| 278 | Ga0466715_120385 | 3300042616 | Bacteria | 32691 |
| 279 | Ga0466729_283479 | 3300042621 | Bacteria | 8952 |
| 280 | Ga0466706_158778 | 3300042599 | Bacteria | 62402 |
| 281 | Ga0466706_181893 | 3300042599 | Unclassified | 5325 |
| 282 | Ga0466706_204451 | 3300042599 | Bacteria | 2252 |
| 283 | Ga0466714_016541 | 3300042603 | Bacteria | 13683 |
| 284 | Ga0466717_257708 | 3300042604 | Bacteria | 1524 |
| 285 | Ga0466717_286555 | 3300042604 | Bacteria | 9356 |
| 286 | Ga0466719_123098 | 3300042606 | Bacteria | 142874 |
| 287 | Ga0466720_087401 | 3300042607 | Bacteria | 2173 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00528 | BPD_transp_1 | Binding-protein-dependent transport system inner membrane component | 119 | 318 | 0.78 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.