Protein Family IF04966
Metagenome
Isolate
160
Members
60
Samples
144
Scaffolds
480.3
Avg Length
Representative Sequence
- ID
- 3300042594|Ga0466694_023612|Ga0466694_023612_5398_7050
- Length
- 550 aa
- Sequence
- MDSASTGMAFVSLLTMHDDNANSVNRDSTIKCIPVFFADMADSPLVDIFILLYPQKGNYTMKKFMDNNFLLSTKTAKKLYHEAAKAEPIFDYHCHLIPQEIAEDRRFPDLASVWLGGDHYKWRAMRANGVSEMLVTGKAEPYEKFLAWADTVPRLIGNPLYHWTHLELRRYFDISEPLNPHSAPAIWKAANERLARDTSLSVFGIFKKFNVFATGTTDDPADSLEWHKKVYAQGATGTKVLPSFRPDRIINIEKPDFAEYIARLAQAAGTRINSLDDLLRVIQNRIAFFHDASCRICDHGLDYVPFATASDDPCLARPAEINFSKWEKEMKDIFARALNGKKPNAAETESWKTFLLNFLGEEYAERDWAMQIHLAAIRSNNTAALTALGPDTGYDAVHDYPAAEKLARLMDLLFSRDKLPKTILYSLNIKDLYPLATLMGCFQGEINPAKQVIPGKIQLGSGWWFLDHIDGMETQMRLLGNTGLLSRFVGMLTDSRSFLSYPRHEYFRRILCNILGTWAENGEIPNDFDLLGGMVRDISFRNAQRYFNVP
Sample Types
Isolate
10.0%
Metagenome
90.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.8%
Kalotermitidae
20.7%
Unclassified
19.0%
Rhinotermitidae
3.4%
Termopsidae
3.4%
Culicidae
3.4%
Passalidae
1.7%
Pyrrhocoridae
1.7%
Hodotermitidae
1.7%
Taxonomy
Archaea
0
Bacteria
159
Eukaryota
0
Viruses
0
Unclassified
1
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 9 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 10 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 11 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 12 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 13 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 14 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 15 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 16 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 17 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 18 | 2820303403 | Unclassified Firmicutes Th196P1bin2 | Isolate | Unclassified |
| 19 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 20 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 21 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 22 | 2503538010 | Coriobacterium glomerans PW2, DSM 20642 | Isolate | Pyrrhocoridae |
| 23 | 2593339124 | Clostridium sp. 4 | Isolate | Termitidae |
| 24 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 25 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 26 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 27 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 28 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 29 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 30 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 31 | 8063587521 | Entomospira entomophilus BR193 | Isolate | Culicidae |
| 32 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 33 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 34 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 35 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 36 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 37 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 38 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 39 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 40 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 41 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 42 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 43 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 44 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 45 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 46 | 2820318056 | Unclassified Firmicutes Nt197P3bin94 | Isolate | Unclassified |
| 47 | 2820414148 | Unclassified Firmicutes Lab288P3bin93 | Isolate | Unclassified |
| 48 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 49 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 50 | 2964130733 | Entomospira entomophilus BR193 | Isolate | Culicidae |
| 51 | 2820314258 | Unclassified Firmicutes Nt197P4bin16 | Isolate | Unclassified |
| 52 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 53 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 54 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 55 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 56 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 57 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 58 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 59 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 60 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24702J35022_10035693 | 3300002462 | Bacteria | 2659 |
| 2 | JGI24699J35502_11133802 | 3300002509 | Bacteria | 15866 |
| 3 | Ga0466710_364278 | 3300042613 | Bacteria | 1755 |
| 4 | Ga0466712_323757 | 3300042614 | Bacteria | 19517 |
| 5 | Ga0466715_227450 | 3300042616 | Bacteria | 2129 |
| 6 | Ga0466700_433098 | 3300042600 | Bacteria | 2290 |
| 7 | Ga0466719_564777 | 3300042606 | Bacteria | 7476 |
| 8 | Ga0466720_062662 | 3300042607 | Bacteria | 2898 |
| 9 | Ga0466720_065521 | 3300042607 | Bacteria | 16476 |
| 10 | Ga0466722_044747 | 3300042609 | Bacteria | 5923 |
| 11 | Ga0466722_249795 | 3300042609 | Bacteria | 5040 |
| 12 | Ga0466690_329394 | 3300042590 | Bacteria | 2489 |
| 13 | Ga0466694_238586 | 3300042594 | Bacteria | 7384 |
| 14 | Ga0466699_051384 | 3300042597 | Bacteria | 2104 |
| 15 | Ga0466732_111305 | 3300042656 | Bacteria | 5379 |
| 16 | JGI24698J34947_10004408 | 3300002449 | Bacteria | 7663 |
| 17 | JGI24698J34947_10006183 | 3300002449 | Bacteria | 6576 |
| 18 | Ga0072941_1017510 | 3300005201 | Bacteria | 10966 |
| 19 | Ga0466712_044752 | 3300042614 | Bacteria | 8502 |
| 20 | Ga0466711_308404 | 3300042615 | Bacteria | 17331 |
| 21 | Ga0466723_077817 | 3300042618 | Bacteria | 8804 |
| 22 | Ga0466719_244648 | 3300042606 | Bacteria | 13008 |
| 23 | Ga0466720_093891 | 3300042607 | Bacteria | 26484 |
| 24 | Ga0466720_158071 | 3300042607 | Bacteria | 21754 |
| 25 | Ga0466720_160501 | 3300042607 | Bacteria | 20483 |
| 26 | Ga0466722_039585 | 3300042609 | Bacteria | 7750 |
| 27 | Ga0466698_214701 | 3300042610 | Bacteria | 2549 |
| 28 | Ga0466698_398215 | 3300042610 | Bacteria | 8567 |
| 29 | Ga0264413_158263 | 3300024493 | Bacteria | 3059 |
| 30 | Ga0466694_023612 | 3300042594 | Bacteria | 17845 |
| 31 | Ga0466694_294101 | 3300042594 | Bacteria | 3239 |
| 32 | Ga0466699_005029 | 3300042597 | Bacteria | 8354 |
| 33 | Ga0466699_023149 | 3300042597 | Bacteria | 14027 |
| 34 | Ga0466699_026948 | 3300042597 | Bacteria | 6038 |
| 35 | Ga0466699_058000 | 3300042597 | Bacteria | 7275 |
| 36 | Ga0466699_114387 | 3300042597 | Bacteria | 28326 |
| 37 | Ga0466699_204433 | 3300042597 | Bacteria | 21386 |
| 38 | Ga0466735_025797 | 3300042624 | Bacteria | 2391 |
| 39 | Ga0466709_406816 | 3300042648 | Bacteria | 10177 |
| 40 | Ga0466732_084693 | 3300042656 | Bacteria | 1709 |
| 41 | Ga0466732_186284 | 3300042656 | Bacteria | 12295 |
| 42 | JGI24698J34947_10004093 | 3300002449 | Bacteria | 7909 |
| 43 | JGI24698J34947_10025936 | 3300002449 | Bacteria | 3116 |
| 44 | Ga0466711_245235 | 3300042615 | Bacteria | 1577 |
| 45 | Ga0466715_094219 | 3300042616 | Bacteria | 2572 |
| 46 | Ga0466720_014365 | 3300042607 | Bacteria | 9932 |
| 47 | Ga0466720_035963 | 3300042607 | Bacteria | 10782 |
| 48 | Ga0466720_051984 | 3300042607 | Bacteria | 7546 |
| 49 | Ga0466720_162180 | 3300042607 | Bacteria | 6221 |
| 50 | Ga0466722_170430 | 3300042609 | Bacteria | 2686 |
| 51 | Ga0466722_188485 | 3300042609 | Bacteria | 26025 |
| 52 | Ga0466722_233804 | 3300042609 | Bacteria | 6556 |
| 53 | Ga0264413_112015 | 3300024493 | Bacteria | 8163 |
| 54 | Ga0466696_139924 | 3300042596 | Bacteria | 3498 |
| 55 | Ga0466699_033001 | 3300042597 | Bacteria | 5237 |
| 56 | Ga0466735_164818 | 3300042624 | Bacteria | 7353 |
| 57 | Ga0466704_458279 | 3300042643 | Bacteria | 24853 |
| 58 | Ga0123353_10148134 | 3300010167 | Bacteria | 3751 |
| 59 | Ga0466733_023577 | 3300042659 | Bacteria | 8970 |
| 60 | JGI24698J34947_10005973 | 3300002449 | Bacteria | 6681 |
| 61 | JGI24705J35276_12235076 | 3300002504 | Bacteria | 6149 |
| 62 | Ga0072941_1003019 | 3300005201 | Bacteria | 56162 |
| 63 | Ga0466712_111965 | 3300042614 | Bacteria | 5216 |
| 64 | Ga0466711_027826 | 3300042615 | Bacteria | 7078 |
| 65 | Ga0466720_017908 | 3300042607 | Bacteria | 4552 |
| 66 | Ga0466722_072715 | 3300042609 | Bacteria | 21761 |
| 67 | Ga0264413_119285 | 3300024493 | Bacteria | 9882 |
| 68 | Ga0466695_277493 | 3300042595 | Bacteria | 5042 |
| 69 | Ga0466696_054381 | 3300042596 | Bacteria | 22881 |
| 70 | Ga0466699_117245 | 3300042597 | Bacteria | 16245 |
| 71 | Ga0466699_144985 | 3300042597 | Bacteria | 5083 |
| 72 | Ga0466699_336695 | 3300042597 | Bacteria | 4269 |
| 73 | Ga0123356_10010310 | 3300010049 | Bacteria | 9175 |
| 74 | Ga0123353_10001115 | 3300010167 | Bacteria | 32664 |
| 75 | Ga0466705_071813 | 3300042612 | Bacteria | 7493 |
| 76 | Ga0466732_317539 | 3300042656 | Bacteria | 6345 |
| 77 | Ga0466733_174779 | 3300042659 | Bacteria | 4975 |
| 78 | JGI24698J34947_10050164 | 3300002449 | Bacteria | 2106 |
| 79 | JGI24700J35501_10929179 | 3300002508 | Bacteria | 8775 |
| 80 | Ga0072941_1021487 | 3300005201 | Bacteria | 7100 |
| 81 | Ga0072941_1023651 | 3300005201 | Bacteria | 12237 |
| 82 | Ga0466712_139828 | 3300042614 | Bacteria | 5364 |
| 83 | Ga0466715_268369 | 3300042616 | Bacteria | 12554 |
| 84 | Ga0466718_012170 | 3300042617 | Bacteria | 13318 |
| 85 | Ga0466722_022028 | 3300042609 | Bacteria | 2817 |
| 86 | Ga0466722_155137 | 3300042609 | Bacteria | 18198 |
| 87 | Ga0466699_196105 | 3300042597 | Bacteria | 4294 |
| 88 | Ga0466699_242223 | 3300042597 | Bacteria | 8789 |
| 89 | Ga0466699_247440 | 3300042597 | Bacteria | 3596 |
| 90 | Ga0123356_10004081 | 3300010049 | Bacteria | 15173 |
| 91 | Ga0123353_10010513 | 3300010167 | Bacteria | 12907 |
| 92 | Ga0466705_005355 | 3300042612 | Bacteria | 12648 |
| 93 | Ga0466705_128834 | 3300042612 | Bacteria | 4891 |
| 94 | IMNBL1DRAFT_c0008616 | 3300000062 | Bacteria | 5171 |
| 95 | AustNasuHG_c1001364 | 3300000089 | Bacteria | 8743 |
| 96 | JGI24698J34947_10008462 | 3300002449 | Bacteria | 5649 |
| 97 | JGI24698J34947_10031653 | 3300002449 | Unclassified | 2782 |
| 98 | JGI24695J34938_10016640 | 3300002450 | Bacteria | 3733 |
| 99 | Ga0072941_1021488 | 3300005201 | Bacteria | 9559 |
| 100 | Ga0466720_027911 | 3300042607 | Bacteria | 16141 |
| 101 | Ga0466722_016522 | 3300042609 | Bacteria | 2571 |
| 102 | Ga0466692_058889 | 3300042591 | Bacteria | 41705 |
| 103 | Ga0466699_245407 | 3300042597 | Bacteria | 4524 |
| 104 | Ga0466699_292240 | 3300042597 | Bacteria | 2077 |
| 105 | Ga0466703_219990 | 3300042636 | Bacteria | 4109 |
| 106 | Ga0123356_10000717 | 3300010049 | Bacteria | 36766 |
| 107 | Ga0123356_10019397 | 3300010049 | Bacteria | 6445 |
| 108 | Ga0123356_10182687 | 3300010049 | Bacteria | 2121 |
| 109 | Ga0123353_10039734 | 3300010167 | Bacteria | 7413 |
| 110 | Ga0123353_10171081 | 3300010167 | Bacteria | 3449 |
| 111 | Ga0466732_175544 | 3300042656 | Bacteria | 18837 |
| 112 | Ga0466733_176135 | 3300042659 | Bacteria | 9521 |
| 113 | Ga0466711_152881 | 3300042615 | Bacteria | 23786 |
| 114 | Ga0466723_086483 | 3300042618 | Bacteria | 21486 |
| 115 | Ga0466720_030042 | 3300042607 | Bacteria | 20620 |
| 116 | Ga0466720_163924 | 3300042607 | Bacteria | 3776 |
| 117 | Ga0466722_195495 | 3300042609 | Bacteria | 4490 |
| 118 | Ga0264413_112230 | 3300024493 | Bacteria | 9505 |
| 119 | Ga0466692_047953 | 3300042591 | Bacteria | 13865 |
| 120 | Ga0466708_093717 | 3300042652 | Bacteria | 8976 |
| 121 | Ga0466727_079547 | 3300042655 | Bacteria | 8888 |
| 122 | Ga0123355_10000276 | 3300009826 | Bacteria | 66090 |
| 123 | Ga0123356_10039014 | 3300010049 | Bacteria | 4425 |
| 124 | Ga0123354_10226406 | 3300010882 | Bacteria | 1969 |
| 125 | Ga0123354_10299907 | 3300010882 | Bacteria | 1522 |
| 126 | JGI24698J34947_10005777 | 3300002449 | Bacteria | 6784 |
| 127 | JGI24698J34947_10021278 | 3300002449 | Bacteria | 3491 |
| 128 | JGI24695J34938_10045681 | 3300002450 | Bacteria | 1942 |
| 129 | Ga0072941_1039562 | 3300005201 | Bacteria | 10220 |
| 130 | Ga0074263_108805 | 3300005485 | Bacteria | 3160 |
| 131 | Ga0466712_038659 | 3300042614 | Bacteria | 14039 |
| 132 | Ga0466712_124345 | 3300042614 | Bacteria | 4494 |
| 133 | Ga0466712_157055 | 3300042614 | Bacteria | 9381 |
| 134 | Ga0466718_063528 | 3300042617 | Bacteria | 34799 |
| 135 | Ga0466706_117928 | 3300042599 | Bacteria | 4065 |
| 136 | Ga0466714_007774 | 3300042603 | Bacteria | 3128 |
| 137 | Ga0466720_131630 | 3300042607 | Bacteria | 8215 |
| 138 | Ga0466690_004723 | 3300042590 | Bacteria | 6569 |
| 139 | Ga0466692_049282 | 3300042591 | Bacteria | 249845 |
| 140 | Ga0466692_203453 | 3300042591 | Bacteria | 53264 |
| 141 | Ga0466691_073234 | 3300042593 | Bacteria | 9834 |
| 142 | Ga0466735_073836 | 3300042624 | Bacteria | 12411 |
| 143 | Ga0123355_10038761 | 3300009826 | Bacteria | 7749 |
| 144 | Ga0123353_10065114 | 3300010167 | Bacteria | 5850 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02614 | UxaC | Glucuronate isomerase | 61 | 547 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.