Protein Family IF04920

Metagenome Isolate
332 Members
85 Samples
307 Scaffolds
368.77 Avg Length

🧬 Representative Sequence

ID
3300042593|Ga0466691_146718|Ga0466691_146718_321_1589
Length
422 aa
Sequence
VPGTQKCAIKTEKKVNAAALTKSLHKSKNKYNLKKEKKLIFWLLNEWRKKVSQHNETVYASFEEMWEFMRLAFIAVGVPAEDAAICADVLIESDKRGIDSHGVGRLKPIYIDRIKEGIQFPVTRFEIVRETPAITVIDGHDGMGHVIGVKAMGMTIQKAKKNGMAMAAVRNSTHYGIAGYYALMAAKENMICFTGTNARPSIAPTFGVENMLGTNPLTIGFPTDEDFPFVIDCATSITQRGKIEHYARINKTMPSGWVIDGEGAAVTDPGVALKGLVAGTCALTPLGGIGEELAGYKGYGYAAVVEVLSAALQGGTFLKALTGINPDGSHRPYHLGHFFMAIDINAFIDPKAFKKTAGDILRELRASKKAAGQDRIYTAGEKEYIAYLERKEKGIPINPAVRASLTAVRDECGVKHTFSWEK

πŸ“Š Sample Types

Isolate 7.5%
Metagenome 92.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 39.8%
Unclassified 30.1%
Kalotermitidae 18.1%
Rhinotermitidae 4.8%
Termopsidae 3.6%
Blattidae 2.4%
Hodotermitidae 1.2%

🌳 Taxonomy

Archaea 1
Bacteria 308
Eukaryota 0
Viruses 0
Unclassified 23

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
2 2820010479 Unclassified Spirochaetes Th196P4bin55 Isolate Unclassified
3 2820018428 Unclassified Spirochaetes Nt197P3bin33 Isolate Unclassified
4 2820298281 Unclassified Firmicutes Th196P1bin9 Isolate Unclassified
5 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
6 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
7 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
8 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
9 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
10 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
11 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
12 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
13 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
14 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
15 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
16 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
17 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
18 2820004052 Unclassified Synergistetes Nt197P3bin25 Isolate Unclassified
19 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
20 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
21 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
22 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
23 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
24 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
25 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
26 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
27 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
28 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
29 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
30 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
31 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
32 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
33 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
34 2503904012 Sphaerochaeta coccoides SPN1, DSM 17374 Isolate Kalotermitidae
35 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
36 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
37 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
38 650716102 Treponema primitia ZAS-2 Isolate Unclassified
39 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
40 2820611732 Unclassified Firmicutes Emb289P1bin19 Isolate Unclassified
41 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
42 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
43 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
44 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
45 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
46 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
47 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
48 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
49 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
50 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
51 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
52 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
53 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
54 2819998259 Unclassified Spirochaetes Nc150P4bin23 Isolate Unclassified
55 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
56 2820657860 Unclassified Firmicutes Co191P4bin15 Isolate Unclassified
57 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
58 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
59 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
60 2820013017 Unclassified Spirochaetes Th196P3bin152 Isolate Unclassified
61 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
62 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
63 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
64 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
65 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
66 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
67 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
68 2820644600 Unclassified Firmicutes Cu122P5bin39 Isolate Unclassified
69 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
70 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
71 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
72 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
73 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
74 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
75 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
76 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
77 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
78 2820408893 Unclassified Firmicutes Lab288P4bin80 Isolate Unclassified
79 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
80 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
81 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
82 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
83 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
84 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
85 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_008097 3300042656 Bacteria 2384
2 Ga0466732_016893 3300042656 Bacteria 22834
3 Ga0466705_401462 3300042612 Bacteria 2803
4 Ga0466712_009463 3300042614 Bacteria 3003
5 Ga0466712_160588 3300042614 Bacteria 10859
6 Ga0466712_309501 3300042614 Bacteria 14310
7 Ga0466712_322727 3300042614 Bacteria 6854
8 Ga0466711_127443 3300042615 Bacteria 5819
9 Ga0466711_220654 3300042615 Bacteria 16182
10 Ga0466715_011553 3300042616 Bacteria 6986
11 Ga0466715_103860 3300042616 Unclassified 8207
12 Ga0466715_214725 3300042616 Bacteria 8731
13 Ga0466718_021014 3300042617 Bacteria 7039
14 Ga0466726_168607 3300042619 Bacteria 2685
15 Ga0466726_220329 3300042619 Bacteria 1571
16 Ga0466726_381496 3300042619 Bacteria 3513
17 Ga0466728_066380 3300042620 Bacteria 3827
18 Ga0466706_280479 3300042599 Bacteria 12470
19 Ga0466706_287129 3300042599 Bacteria 1632
20 Ga0466707_313042 3300042601 Bacteria 3512
21 Ga0466713_088218 3300042602 Bacteria 3212
22 Ga0466716_361593 3300042605 Bacteria 5175
23 Ga0466719_175889 3300042606 Bacteria 6161
24 Ga0123356_10004494 3300010049 Bacteria 14403
25 Ga0123353_10017883 3300010167 Bacteria 10451
26 Ga0123353_10149527 3300010167 Bacteria 3730
27 Ga0123353_10644642 3300010167 Bacteria 1501
28 Ga0123353_10757363 3300010167 Bacteria 1350
29 Ga0123354_10102030 3300010882 Bacteria 3870
30 Ga0123354_10178842 3300010882 Bacteria 2431
31 Ga0466731_087135 3300042622 Bacteria 2157
32 Ga0466702_248413 3300042635 Bacteria 1585
33 Ga0466703_084955 3300042636 Bacteria 22090
34 Ga0466704_541880 3300042643 Bacteria 1623
35 Ga0415639_118019 3300038395 Bacteria 1909
36 Ga0466692_202287 3300042591 Bacteria 2028
37 Ga0466691_225704 3300042593 Bacteria 32229
38 Ga0466694_183857 3300042594 Bacteria 1456
39 Ga0466696_291687 3300042596 Bacteria 4614
40 Ga0466699_125157 3300042597 Archaea 1395
41 JGI24698J34947_10000101 3300002449 Bacteria 29683
42 JGI24698J34947_10000241 3300002449 Bacteria 22787
43 JGI24698J34947_10002367 3300002449 Bacteria 10147
44 JGI24698J34947_10005477 3300002449 Bacteria 6966
45 JGI24698J34947_10029634 3300002449 Bacteria 2890
46 JGI24698J34947_10054174 3300002449 Unclassified 2004
47 JGI24695J34938_10002691 3300002450 Bacteria 13224
48 JGI24702J35022_10002254 3300002462 Bacteria 11841
49 Ga0466705_103743 3300042612 Unclassified 4761
50 Ga0466705_498606 3300042612 Bacteria 2827
51 Ga0466711_026776 3300042615 Bacteria 65764
52 Ga0466715_017607 3300042616 Bacteria 4801
53 Ga0466715_037932 3300042616 Bacteria 49289
54 Ga0466715_101490 3300042616 Bacteria 10666
55 Ga0466715_298776 3300042616 Bacteria 4115
56 Ga0466723_171603 3300042618 Bacteria 1490
57 Ga0466726_069480 3300042619 Bacteria 23044
58 Ga0466726_290169 3300042619 Bacteria 2584
59 Ga0466726_305438 3300042619 Bacteria 3626
60 Ga0466697_023493 3300042611 Bacteria 3149
61 Ga0123356_10017781 3300010049 Bacteria 6754
62 Ga0123356_10135251 3300010049 Bacteria 2422
63 Ga0123356_10492044 3300010049 Bacteria 1381
64 Ga0123353_10111147 3300010167 Bacteria 4414
65 Ga0123353_10153042 3300010167 Bacteria 3680
66 Ga0123353_10254138 3300010167 Bacteria 2719
67 Ga0123353_10386372 3300010167 Bacteria 2091
68 Ga0123353_10474968 3300010167 Bacteria 1831
69 Ga0123353_10570630 3300010167 Bacteria 1626
70 Ga0466704_104803 3300042643 Bacteria 8778
71 Ga0466709_077255 3300042648 Bacteria 3394
72 Ga0466727_113580 3300042655 Bacteria 2577
73 Ga0264413_127214 3300024493 Bacteria 42481
74 Ga0264413_141678 3300024493 Bacteria 7533
75 Ga0415639_027283 3300038395 Bacteria 13570
76 Ga0466690_357010 3300042590 Bacteria 4269
77 Ga0466694_094360 3300042594 Bacteria 1128
78 Ga0466694_210142 3300042594 Bacteria 35335
79 Ga0466694_389754 3300042594 Bacteria 14466
80 JGI24698J34947_10016428 3300002449 Bacteria 4017
81 JGI24695J34938_10000161 3300002450 Bacteria 62308
82 JGI24695J34938_10010089 3300002450 Bacteria 5204
83 JGI24695J34938_10014989 3300002450 Unclassified 3994
84 Ga0466705_035874 3300042612 Bacteria 2363
85 Ga0466705_101379 3300042612 Bacteria 4432
86 Ga0466705_186278 3300042612 Bacteria 37219
87 Ga0466705_412540 3300042612 Bacteria 2449
88 Ga0466712_037275 3300042614 Bacteria 28135
89 Ga0466711_058000 3300042615 Bacteria 8485
90 Ga0466715_044563 3300042616 Bacteria 3094
91 Ga0466715_581174 3300042616 Unclassified 4250
92 Ga0466718_067853 3300042617 Bacteria 3429
93 Ga0466723_093730 3300042618 Bacteria 27934
94 Ga0466729_126865 3300042621 Bacteria 5255
95 Ga0466707_309301 3300042601 Bacteria 5492
96 Ga0466707_317222 3300042601 Bacteria 7544
97 Ga0466707_339352 3300042601 Bacteria 1527
98 Ga0466698_259522 3300042610 Bacteria 2543
99 Ga0123355_10017704 3300009826 Bacteria 11270
100 Ga0123353_10039971 3300010167 Bacteria 7394
101 Ga0123353_10076564 3300010167 Bacteria 5376
102 Ga0466731_355433 3300042622 Bacteria 3426
103 Ga0466703_143084 3300042636 Bacteria 10305
104 Ga0466709_186238 3300042648 Unclassified 3071
105 Ga0466708_059214 3300042652 Bacteria 2974
106 Ga0466708_157149 3300042652 Bacteria 3183
107 Ga0264413_109503 3300024493 Bacteria 7355
108 Ga0466692_144619 3300042591 Bacteria 6310
109 JGI24698J34947_10001511 3300002449 Bacteria 12296
110 JGI24695J34938_10010432 3300002450 Bacteria 5085
111 JGI24700J35501_10927154 3300002508 Bacteria 6650
112 Ga0466705_423232 3300042612 Unclassified 1846
113 Ga0466710_001648 3300042613 Bacteria 1628
114 Ga0466712_011784 3300042614 Bacteria 50228
115 Ga0466712_092678 3300042614 Bacteria 11730
116 Ga0466712_195970 3300042614 Unclassified 1868
117 Ga0466715_039974 3300042616 Bacteria 4443
118 Ga0466715_112058 3300042616 Bacteria 8864
119 Ga0466715_132003 3300042616 Bacteria 62355
120 Ga0466715_530353 3300042616 Bacteria 19847
121 Ga0466723_203080 3300042618 Bacteria 9115
122 Ga0466713_148315 3300042602 Bacteria 7257
123 Ga0466716_443608 3300042605 Unclassified 2473
124 Ga0466719_225450 3300042606 Bacteria 68670
125 Ga0466698_010327 3300042610 Bacteria 5300
126 Ga0123353_10355069 3300010167 Unclassified 2206
127 Ga0466703_196559 3300042636 Bacteria 17099
128 Ga0466704_485852 3300042643 Bacteria 1613
129 Ga0466709_009047 3300042648 Bacteria 4693
130 Ga0466708_198335 3300042652 Bacteria 35517
131 Ga0466727_186527 3300042655 Bacteria 5235
132 Ga0466690_027567 3300042590 Bacteria 4347
133 Ga0466694_024995 3300042594 Bacteria 2326
134 Ga0466694_131280 3300042594 Bacteria 2605
135 Ga0466695_181682 3300042595 Bacteria 45915
136 JGI24698J34947_10056893 3300002449 Bacteria 1942
137 JGI24695J34938_10000036 3300002450 Bacteria 101915
138 JGI24695J34938_10000213 3300002450 Bacteria 55352
139 JGI24696J40584_12957074 3300002834 Bacteria 3342
140 Ga0068305_10080103 3300005083 Bacteria 5111
141 Ga0466705_108372 3300042612 Bacteria 3003
142 Ga0466705_201414 3300042612 Bacteria 11846
143 Ga0466705_231895 3300042612 Bacteria 1256
144 Ga0466733_164584 3300042659 Bacteria 2118
145 Ga0466712_002059 3300042614 Bacteria 10720
146 Ga0466712_032445 3300042614 Bacteria 3251
147 Ga0466712_055787 3300042614 Bacteria 25522
148 Ga0466712_093993 3300042614 Bacteria 15046
149 Ga0466715_471206 3300042616 Bacteria 8445
150 Ga0466715_537053 3300042616 Bacteria 2465
151 Ga0466715_550558 3300042616 Bacteria 2412
152 Ga0466718_025756 3300042617 Bacteria 5138
153 Ga0466723_013033 3300042618 Unclassified 8440
154 Ga0466723_097307 3300042618 Bacteria 6740
155 Ga0466723_155571 3300042618 Bacteria 25504
156 Ga0466723_230345 3300042618 Bacteria 35290
157 Ga0466726_282038 3300042619 Bacteria 1264
158 Ga0466706_115669 3300042599 Bacteria 4113
159 Ga0466714_040031 3300042603 Bacteria 6555
160 Ga0466716_026257 3300042605 Bacteria 34671
161 Ga0466719_012909 3300042606 Bacteria 11835
162 Ga0466719_239456 3300042606 Unclassified 1936
163 Ga0466719_378974 3300042606 Bacteria 9253
164 Ga0466720_144118 3300042607 Bacteria 25436
165 Ga0466722_035110 3300042609 Bacteria 9567
166 Ga0123353_10008746 3300010167 Bacteria 13871
167 Ga0123353_10169687 3300010167 Bacteria 3465
168 Ga0123353_10530734 3300010167 Bacteria 1704
169 Ga0466731_082966 3300042622 Bacteria 2203
170 Ga0466702_125101 3300042635 Bacteria 5591
171 Ga0466704_098643 3300042643 Bacteria 2557
172 Ga0466704_194291 3300042643 Unclassified 3627
173 Ga0466709_326410 3300042648 Bacteria 2149
174 Ga0466708_097006 3300042652 Bacteria 6092
175 Ga0466725_343197 3300042654 Unclassified 7215
176 Ga0466656_119156 3300042550 Bacteria 1365
177 Ga0466690_048731 3300042590 Bacteria 8461
178 Ga0466691_064109 3300042593 Bacteria 2614
179 Ga0466691_146718 3300042593 Unclassified 3053
180 Ga0466694_373612 3300042594 Bacteria 2059
181 Ga0466696_176785 3300042596 Bacteria 19925
182 Ga0466699_053014 3300042597 Bacteria 15726
183 Ga0466699_175396 3300042597 Bacteria 2676
184 Ga0466699_273950 3300042597 Bacteria 2975
185 AustNasuHG_c1011636 3300000089 Bacteria 3047
186 JGI24702J35022_10000367 3300002462 Bacteria 26825
187 JGI24702J35022_10008950 3300002462 Bacteria 5643
188 Ga0072940_1050513 3300005200 Bacteria 9126
189 Ga0466705_073840 3300042612 Bacteria 2550
190 Ga0466712_235554 3300042614 Bacteria 5243
191 Ga0466711_303594 3300042615 Bacteria 7574
192 Ga0466715_234926 3300042616 Bacteria 12238
193 Ga0466726_167869 3300042619 Bacteria 2392
194 Ga0466728_241233 3300042620 Bacteria 1312
195 Ga0466728_330118 3300042620 Bacteria 2444
196 Ga0466706_024227 3300042599 Bacteria 2086
197 Ga0466707_140733 3300042601 Bacteria 6395
198 Ga0466707_187385 3300042601 Bacteria 22990
199 Ga0466716_067248 3300042605 Bacteria 4039
200 Ga0466716_171021 3300042605 Bacteria 5352
201 Ga0466719_126760 3300042606 Bacteria 30509
202 Ga0466720_027153 3300042607 Bacteria 13715
203 Ga0123356_10064205 3300010049 Bacteria 3432
204 Ga0123356_10068269 3300010049 Bacteria 3330
205 Ga0123356_10482783 3300010049 Bacteria 1392
206 Ga0466731_021178 3300042622 Bacteria 1317
207 Ga0466731_426027 3300042622 Bacteria 2116
208 Ga0466702_232704 3300042635 Unclassified 2361
209 Ga0466703_182941 3300042636 Bacteria 21148
210 Ga0466703_188942 3300042636 Bacteria 3444
211 Ga0466703_239645 3300042636 Bacteria 8010
212 Ga0466704_216804 3300042643 Bacteria 12927
213 Ga0466704_363584 3300042643 Bacteria 4278
214 Ga0466704_466222 3300042643 Bacteria 45364
215 Ga0466709_029560 3300042648 Bacteria 15471
216 Ga0466709_130631 3300042648 Bacteria 8981
217 Ga0466725_205215 3300042654 Bacteria 1936
218 Ga0466692_069201 3300042591 Bacteria 165617
219 Ga0466694_280127 3300042594 Bacteria 1264
220 Ga0466696_026717 3300042596 Bacteria 3521
221 Ga0466699_185635 3300042597 Bacteria 14924
222 AustNasuHG_c1000106 3300000089 Bacteria 25236
223 AustNasuHG_c1000261 3300000089 Bacteria 17949
224 JGI24698J34947_10005111 3300002449 Bacteria 7189
225 Ga0466697_182033 3300042611 Bacteria 1346
226 Ga0466705_250409 3300042612 Bacteria 2646
227 Ga0466712_030681 3300042614 Bacteria 58628
228 Ga0466712_227094 3300042614 Bacteria 39101
229 Ga0466715_189379 3300042616 Bacteria 17590
230 Ga0466718_015822 3300042617 Bacteria 9482
231 Ga0466723_011379 3300042618 Bacteria 6701
232 Ga0466723_131066 3300042618 Bacteria 51139
233 Ga0466726_111742 3300042619 Bacteria 7247
234 Ga0466726_313520 3300042619 Bacteria 2256
235 Ga0466726_386039 3300042619 Bacteria 1402
236 Ga0466728_360705 3300042620 Bacteria 4160
237 Ga0466729_029115 3300042621 Bacteria 4148
238 Ga0466729_061284 3300042621 Bacteria 3137
239 Ga0466707_079109 3300042601 Bacteria 1410
240 Ga0466716_144611 3300042605 Bacteria 3197
241 Ga0466719_138499 3300042606 Bacteria 3667
242 Ga0466720_037163 3300042607 Bacteria 5701
243 Ga0466720_178749 3300042607 Bacteria 1774
244 Ga0466722_081903 3300042609 Bacteria 33985
245 Ga0123353_10022089 3300010167 Bacteria 9575
246 Ga0123353_10155086 3300010167 Bacteria 3652
247 Ga0123353_10296540 3300010167 Bacteria 2471
248 Ga0123354_10008024 3300010882 Bacteria 16017
249 Ga0123354_10248893 3300010882 Bacteria 1807
250 Ga0466703_191139 3300042636 Bacteria 1799
251 Ga0466704_099199 3300042643 Unclassified 3127
252 Ga0466704_178482 3300042643 Unclassified 3618
253 Ga0466708_075305 3300042652 Bacteria 13330
254 Ga0466708_304569 3300042652 Bacteria 2264
255 Ga0466708_454366 3300042652 Bacteria 3435
256 Ga0456237_0011823 3300041968 Bacteria 1271
257 Ga0466690_090343 3300042590 Bacteria 10868
258 Ga0466690_203975 3300042590 Bacteria 9971
259 Ga0466693_145825 3300042592 Bacteria 23378
260 Ga0466695_234247 3300042595 Bacteria 1251
261 Ga0466696_135420 3300042596 Bacteria 3530
262 JGI24702J35022_10004605 3300002462 Bacteria 8176
263 JGI24705J35276_12225180 3300002504 Bacteria 2690
264 JGI24697J35500_11271052 3300002507 Bacteria 4387
265 JGI24696J40584_12960716 3300002834 Bacteria 8166
266 Ga0466705_304497 3300042612 Unclassified 14150
267 Ga0466733_141671 3300042659 Bacteria 5344
268 Ga0466733_217443 3300042659 Bacteria 1193
269 Ga0466712_043625 3300042614 Bacteria 22329
270 Ga0466712_271848 3300042614 Bacteria 18335
271 Ga0466715_120690 3300042616 Bacteria 9019
272 Ga0466726_017697 3300042619 Bacteria 16163
273 Ga0466726_276552 3300042619 Bacteria 3163
274 Ga0466728_084744 3300042620 Bacteria 6408
275 Ga0466728_351434 3300042620 Bacteria 2864
276 Ga0466707_007102 3300042601 Bacteria 2898
277 Ga0466707_114935 3300042601 Bacteria 24732
278 Ga0466707_351640 3300042601 Unclassified 3757
279 Ga0466714_168250 3300042603 Bacteria 2994
280 Ga0466717_076244 3300042604 Bacteria 1962
281 Ga0466717_157578 3300042604 Bacteria 1456
282 Ga0466716_140413 3300042605 Bacteria 7255
283 Ga0466719_245081 3300042606 Bacteria 17816
284 Ga0466719_396572 3300042606 Unclassified 1959
285 Ga0466720_045720 3300042607 Bacteria 5503
286 Ga0466720_167876 3300042607 Bacteria 6291
287 Ga0466720_191196 3300042607 Bacteria 4804
288 Ga0123353_10325042 3300010167 Bacteria 2332
289 Ga0466735_236047 3300042624 Bacteria 12890
290 Ga0466702_250280 3300042635 Bacteria 23290
291 Ga0466703_134364 3300042636 Bacteria 6632
292 Ga0466709_159481 3300042648 Bacteria 3159
293 Ga0466709_222586 3300042648 Unclassified 2247
294 Ga0466708_051842 3300042652 Bacteria 13122
295 Ga0466708_073929 3300042652 Bacteria 19339
296 Ga0264413_110605 3300024493 Bacteria 7648
297 Ga0466690_189737 3300042590 Bacteria 2477
298 Ga0466690_241194 3300042590 Bacteria 2914
299 Ga0466691_198559 3300042593 Bacteria 13562
300 Ga0466691_199472 3300042593 Bacteria 1983
301 Ga0466699_130593 3300042597 Bacteria 1638
302 JGI24698J34947_10011943 3300002449 Bacteria 4768
303 JGI24695J34938_10000741 3300002450 Bacteria 30647
304 JGI24695J34938_10002296 3300002450 Bacteria 14738
305 JGI24695J34938_10005341 3300002450 Bacteria 8035
306 JGI24699J35502_11097733 3300002509 Unclassified 2277
307 Ga0072941_1005931 3300005201 Bacteria 16771

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02615 Ldh_2 Malate/L-lactate dehydrogenase 61 405 0.98

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02615 GO:0016491 oxidoreductase activity MF

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.