Protein Family IF04920
Metagenome
Isolate
332
Members
85
Samples
307
Scaffolds
368.77
Avg Length
Representative Sequence
- ID
- 3300042593|Ga0466691_146718|Ga0466691_146718_321_1589
- Length
- 422 aa
- Sequence
- VPGTQKCAIKTEKKVNAAALTKSLHKSKNKYNLKKEKKLIFWLLNEWRKKVSQHNETVYASFEEMWEFMRLAFIAVGVPAEDAAICADVLIESDKRGIDSHGVGRLKPIYIDRIKEGIQFPVTRFEIVRETPAITVIDGHDGMGHVIGVKAMGMTIQKAKKNGMAMAAVRNSTHYGIAGYYALMAAKENMICFTGTNARPSIAPTFGVENMLGTNPLTIGFPTDEDFPFVIDCATSITQRGKIEHYARINKTMPSGWVIDGEGAAVTDPGVALKGLVAGTCALTPLGGIGEELAGYKGYGYAAVVEVLSAALQGGTFLKALTGINPDGSHRPYHLGHFFMAIDINAFIDPKAFKKTAGDILRELRASKKAAGQDRIYTAGEKEYIAYLERKEKGIPINPAVRASLTAVRDECGVKHTFSWEK
Sample Types
Isolate
7.5%
Metagenome
92.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.8%
Unclassified
30.1%
Kalotermitidae
18.1%
Rhinotermitidae
4.8%
Termopsidae
3.6%
Blattidae
2.4%
Hodotermitidae
1.2%
Taxonomy
Archaea
1
Bacteria
308
Eukaryota
0
Viruses
0
Unclassified
23
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 2 | 2820010479 | Unclassified Spirochaetes Th196P4bin55 | Isolate | Unclassified |
| 3 | 2820018428 | Unclassified Spirochaetes Nt197P3bin33 | Isolate | Unclassified |
| 4 | 2820298281 | Unclassified Firmicutes Th196P1bin9 | Isolate | Unclassified |
| 5 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 6 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 7 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 8 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 9 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 10 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 11 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 12 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 13 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 14 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 15 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 16 | 2940218408 | Enterococcus sp. PF1-24 | Isolate | Blattidae |
| 17 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 18 | 2820004052 | Unclassified Synergistetes Nt197P3bin25 | Isolate | Unclassified |
| 19 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 20 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 21 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 22 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 23 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 24 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 25 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 26 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 27 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 28 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 29 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 30 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 31 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 32 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 33 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 34 | 2503904012 | Sphaerochaeta coccoides SPN1, DSM 17374 | Isolate | Kalotermitidae |
| 35 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 36 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 37 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 38 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 39 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 40 | 2820611732 | Unclassified Firmicutes Emb289P1bin19 | Isolate | Unclassified |
| 41 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 42 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 43 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 44 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 45 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 46 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 47 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 48 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 49 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 50 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 51 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 52 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 53 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 54 | 2819998259 | Unclassified Spirochaetes Nc150P4bin23 | Isolate | Unclassified |
| 55 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 56 | 2820657860 | Unclassified Firmicutes Co191P4bin15 | Isolate | Unclassified |
| 57 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 58 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 59 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 60 | 2820013017 | Unclassified Spirochaetes Th196P3bin152 | Isolate | Unclassified |
| 61 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 62 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 63 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 64 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 65 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 66 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 67 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 68 | 2820644600 | Unclassified Firmicutes Cu122P5bin39 | Isolate | Unclassified |
| 69 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 70 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 71 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 72 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 73 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 74 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 75 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 76 | 2940261461 | Enterococcus sp. PFB1-1 | Isolate | Blattidae |
| 77 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 78 | 2820408893 | Unclassified Firmicutes Lab288P4bin80 | Isolate | Unclassified |
| 79 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 80 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 81 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 82 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 83 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 84 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 85 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_008097 | 3300042656 | Bacteria | 2384 |
| 2 | Ga0466732_016893 | 3300042656 | Bacteria | 22834 |
| 3 | Ga0466705_401462 | 3300042612 | Bacteria | 2803 |
| 4 | Ga0466712_009463 | 3300042614 | Bacteria | 3003 |
| 5 | Ga0466712_160588 | 3300042614 | Bacteria | 10859 |
| 6 | Ga0466712_309501 | 3300042614 | Bacteria | 14310 |
| 7 | Ga0466712_322727 | 3300042614 | Bacteria | 6854 |
| 8 | Ga0466711_127443 | 3300042615 | Bacteria | 5819 |
| 9 | Ga0466711_220654 | 3300042615 | Bacteria | 16182 |
| 10 | Ga0466715_011553 | 3300042616 | Bacteria | 6986 |
| 11 | Ga0466715_103860 | 3300042616 | Unclassified | 8207 |
| 12 | Ga0466715_214725 | 3300042616 | Bacteria | 8731 |
| 13 | Ga0466718_021014 | 3300042617 | Bacteria | 7039 |
| 14 | Ga0466726_168607 | 3300042619 | Bacteria | 2685 |
| 15 | Ga0466726_220329 | 3300042619 | Bacteria | 1571 |
| 16 | Ga0466726_381496 | 3300042619 | Bacteria | 3513 |
| 17 | Ga0466728_066380 | 3300042620 | Bacteria | 3827 |
| 18 | Ga0466706_280479 | 3300042599 | Bacteria | 12470 |
| 19 | Ga0466706_287129 | 3300042599 | Bacteria | 1632 |
| 20 | Ga0466707_313042 | 3300042601 | Bacteria | 3512 |
| 21 | Ga0466713_088218 | 3300042602 | Bacteria | 3212 |
| 22 | Ga0466716_361593 | 3300042605 | Bacteria | 5175 |
| 23 | Ga0466719_175889 | 3300042606 | Bacteria | 6161 |
| 24 | Ga0123356_10004494 | 3300010049 | Bacteria | 14403 |
| 25 | Ga0123353_10017883 | 3300010167 | Bacteria | 10451 |
| 26 | Ga0123353_10149527 | 3300010167 | Bacteria | 3730 |
| 27 | Ga0123353_10644642 | 3300010167 | Bacteria | 1501 |
| 28 | Ga0123353_10757363 | 3300010167 | Bacteria | 1350 |
| 29 | Ga0123354_10102030 | 3300010882 | Bacteria | 3870 |
| 30 | Ga0123354_10178842 | 3300010882 | Bacteria | 2431 |
| 31 | Ga0466731_087135 | 3300042622 | Bacteria | 2157 |
| 32 | Ga0466702_248413 | 3300042635 | Bacteria | 1585 |
| 33 | Ga0466703_084955 | 3300042636 | Bacteria | 22090 |
| 34 | Ga0466704_541880 | 3300042643 | Bacteria | 1623 |
| 35 | Ga0415639_118019 | 3300038395 | Bacteria | 1909 |
| 36 | Ga0466692_202287 | 3300042591 | Bacteria | 2028 |
| 37 | Ga0466691_225704 | 3300042593 | Bacteria | 32229 |
| 38 | Ga0466694_183857 | 3300042594 | Bacteria | 1456 |
| 39 | Ga0466696_291687 | 3300042596 | Bacteria | 4614 |
| 40 | Ga0466699_125157 | 3300042597 | Archaea | 1395 |
| 41 | JGI24698J34947_10000101 | 3300002449 | Bacteria | 29683 |
| 42 | JGI24698J34947_10000241 | 3300002449 | Bacteria | 22787 |
| 43 | JGI24698J34947_10002367 | 3300002449 | Bacteria | 10147 |
| 44 | JGI24698J34947_10005477 | 3300002449 | Bacteria | 6966 |
| 45 | JGI24698J34947_10029634 | 3300002449 | Bacteria | 2890 |
| 46 | JGI24698J34947_10054174 | 3300002449 | Unclassified | 2004 |
| 47 | JGI24695J34938_10002691 | 3300002450 | Bacteria | 13224 |
| 48 | JGI24702J35022_10002254 | 3300002462 | Bacteria | 11841 |
| 49 | Ga0466705_103743 | 3300042612 | Unclassified | 4761 |
| 50 | Ga0466705_498606 | 3300042612 | Bacteria | 2827 |
| 51 | Ga0466711_026776 | 3300042615 | Bacteria | 65764 |
| 52 | Ga0466715_017607 | 3300042616 | Bacteria | 4801 |
| 53 | Ga0466715_037932 | 3300042616 | Bacteria | 49289 |
| 54 | Ga0466715_101490 | 3300042616 | Bacteria | 10666 |
| 55 | Ga0466715_298776 | 3300042616 | Bacteria | 4115 |
| 56 | Ga0466723_171603 | 3300042618 | Bacteria | 1490 |
| 57 | Ga0466726_069480 | 3300042619 | Bacteria | 23044 |
| 58 | Ga0466726_290169 | 3300042619 | Bacteria | 2584 |
| 59 | Ga0466726_305438 | 3300042619 | Bacteria | 3626 |
| 60 | Ga0466697_023493 | 3300042611 | Bacteria | 3149 |
| 61 | Ga0123356_10017781 | 3300010049 | Bacteria | 6754 |
| 62 | Ga0123356_10135251 | 3300010049 | Bacteria | 2422 |
| 63 | Ga0123356_10492044 | 3300010049 | Bacteria | 1381 |
| 64 | Ga0123353_10111147 | 3300010167 | Bacteria | 4414 |
| 65 | Ga0123353_10153042 | 3300010167 | Bacteria | 3680 |
| 66 | Ga0123353_10254138 | 3300010167 | Bacteria | 2719 |
| 67 | Ga0123353_10386372 | 3300010167 | Bacteria | 2091 |
| 68 | Ga0123353_10474968 | 3300010167 | Bacteria | 1831 |
| 69 | Ga0123353_10570630 | 3300010167 | Bacteria | 1626 |
| 70 | Ga0466704_104803 | 3300042643 | Bacteria | 8778 |
| 71 | Ga0466709_077255 | 3300042648 | Bacteria | 3394 |
| 72 | Ga0466727_113580 | 3300042655 | Bacteria | 2577 |
| 73 | Ga0264413_127214 | 3300024493 | Bacteria | 42481 |
| 74 | Ga0264413_141678 | 3300024493 | Bacteria | 7533 |
| 75 | Ga0415639_027283 | 3300038395 | Bacteria | 13570 |
| 76 | Ga0466690_357010 | 3300042590 | Bacteria | 4269 |
| 77 | Ga0466694_094360 | 3300042594 | Bacteria | 1128 |
| 78 | Ga0466694_210142 | 3300042594 | Bacteria | 35335 |
| 79 | Ga0466694_389754 | 3300042594 | Bacteria | 14466 |
| 80 | JGI24698J34947_10016428 | 3300002449 | Bacteria | 4017 |
| 81 | JGI24695J34938_10000161 | 3300002450 | Bacteria | 62308 |
| 82 | JGI24695J34938_10010089 | 3300002450 | Bacteria | 5204 |
| 83 | JGI24695J34938_10014989 | 3300002450 | Unclassified | 3994 |
| 84 | Ga0466705_035874 | 3300042612 | Bacteria | 2363 |
| 85 | Ga0466705_101379 | 3300042612 | Bacteria | 4432 |
| 86 | Ga0466705_186278 | 3300042612 | Bacteria | 37219 |
| 87 | Ga0466705_412540 | 3300042612 | Bacteria | 2449 |
| 88 | Ga0466712_037275 | 3300042614 | Bacteria | 28135 |
| 89 | Ga0466711_058000 | 3300042615 | Bacteria | 8485 |
| 90 | Ga0466715_044563 | 3300042616 | Bacteria | 3094 |
| 91 | Ga0466715_581174 | 3300042616 | Unclassified | 4250 |
| 92 | Ga0466718_067853 | 3300042617 | Bacteria | 3429 |
| 93 | Ga0466723_093730 | 3300042618 | Bacteria | 27934 |
| 94 | Ga0466729_126865 | 3300042621 | Bacteria | 5255 |
| 95 | Ga0466707_309301 | 3300042601 | Bacteria | 5492 |
| 96 | Ga0466707_317222 | 3300042601 | Bacteria | 7544 |
| 97 | Ga0466707_339352 | 3300042601 | Bacteria | 1527 |
| 98 | Ga0466698_259522 | 3300042610 | Bacteria | 2543 |
| 99 | Ga0123355_10017704 | 3300009826 | Bacteria | 11270 |
| 100 | Ga0123353_10039971 | 3300010167 | Bacteria | 7394 |
| 101 | Ga0123353_10076564 | 3300010167 | Bacteria | 5376 |
| 102 | Ga0466731_355433 | 3300042622 | Bacteria | 3426 |
| 103 | Ga0466703_143084 | 3300042636 | Bacteria | 10305 |
| 104 | Ga0466709_186238 | 3300042648 | Unclassified | 3071 |
| 105 | Ga0466708_059214 | 3300042652 | Bacteria | 2974 |
| 106 | Ga0466708_157149 | 3300042652 | Bacteria | 3183 |
| 107 | Ga0264413_109503 | 3300024493 | Bacteria | 7355 |
| 108 | Ga0466692_144619 | 3300042591 | Bacteria | 6310 |
| 109 | JGI24698J34947_10001511 | 3300002449 | Bacteria | 12296 |
| 110 | JGI24695J34938_10010432 | 3300002450 | Bacteria | 5085 |
| 111 | JGI24700J35501_10927154 | 3300002508 | Bacteria | 6650 |
| 112 | Ga0466705_423232 | 3300042612 | Unclassified | 1846 |
| 113 | Ga0466710_001648 | 3300042613 | Bacteria | 1628 |
| 114 | Ga0466712_011784 | 3300042614 | Bacteria | 50228 |
| 115 | Ga0466712_092678 | 3300042614 | Bacteria | 11730 |
| 116 | Ga0466712_195970 | 3300042614 | Unclassified | 1868 |
| 117 | Ga0466715_039974 | 3300042616 | Bacteria | 4443 |
| 118 | Ga0466715_112058 | 3300042616 | Bacteria | 8864 |
| 119 | Ga0466715_132003 | 3300042616 | Bacteria | 62355 |
| 120 | Ga0466715_530353 | 3300042616 | Bacteria | 19847 |
| 121 | Ga0466723_203080 | 3300042618 | Bacteria | 9115 |
| 122 | Ga0466713_148315 | 3300042602 | Bacteria | 7257 |
| 123 | Ga0466716_443608 | 3300042605 | Unclassified | 2473 |
| 124 | Ga0466719_225450 | 3300042606 | Bacteria | 68670 |
| 125 | Ga0466698_010327 | 3300042610 | Bacteria | 5300 |
| 126 | Ga0123353_10355069 | 3300010167 | Unclassified | 2206 |
| 127 | Ga0466703_196559 | 3300042636 | Bacteria | 17099 |
| 128 | Ga0466704_485852 | 3300042643 | Bacteria | 1613 |
| 129 | Ga0466709_009047 | 3300042648 | Bacteria | 4693 |
| 130 | Ga0466708_198335 | 3300042652 | Bacteria | 35517 |
| 131 | Ga0466727_186527 | 3300042655 | Bacteria | 5235 |
| 132 | Ga0466690_027567 | 3300042590 | Bacteria | 4347 |
| 133 | Ga0466694_024995 | 3300042594 | Bacteria | 2326 |
| 134 | Ga0466694_131280 | 3300042594 | Bacteria | 2605 |
| 135 | Ga0466695_181682 | 3300042595 | Bacteria | 45915 |
| 136 | JGI24698J34947_10056893 | 3300002449 | Bacteria | 1942 |
| 137 | JGI24695J34938_10000036 | 3300002450 | Bacteria | 101915 |
| 138 | JGI24695J34938_10000213 | 3300002450 | Bacteria | 55352 |
| 139 | JGI24696J40584_12957074 | 3300002834 | Bacteria | 3342 |
| 140 | Ga0068305_10080103 | 3300005083 | Bacteria | 5111 |
| 141 | Ga0466705_108372 | 3300042612 | Bacteria | 3003 |
| 142 | Ga0466705_201414 | 3300042612 | Bacteria | 11846 |
| 143 | Ga0466705_231895 | 3300042612 | Bacteria | 1256 |
| 144 | Ga0466733_164584 | 3300042659 | Bacteria | 2118 |
| 145 | Ga0466712_002059 | 3300042614 | Bacteria | 10720 |
| 146 | Ga0466712_032445 | 3300042614 | Bacteria | 3251 |
| 147 | Ga0466712_055787 | 3300042614 | Bacteria | 25522 |
| 148 | Ga0466712_093993 | 3300042614 | Bacteria | 15046 |
| 149 | Ga0466715_471206 | 3300042616 | Bacteria | 8445 |
| 150 | Ga0466715_537053 | 3300042616 | Bacteria | 2465 |
| 151 | Ga0466715_550558 | 3300042616 | Bacteria | 2412 |
| 152 | Ga0466718_025756 | 3300042617 | Bacteria | 5138 |
| 153 | Ga0466723_013033 | 3300042618 | Unclassified | 8440 |
| 154 | Ga0466723_097307 | 3300042618 | Bacteria | 6740 |
| 155 | Ga0466723_155571 | 3300042618 | Bacteria | 25504 |
| 156 | Ga0466723_230345 | 3300042618 | Bacteria | 35290 |
| 157 | Ga0466726_282038 | 3300042619 | Bacteria | 1264 |
| 158 | Ga0466706_115669 | 3300042599 | Bacteria | 4113 |
| 159 | Ga0466714_040031 | 3300042603 | Bacteria | 6555 |
| 160 | Ga0466716_026257 | 3300042605 | Bacteria | 34671 |
| 161 | Ga0466719_012909 | 3300042606 | Bacteria | 11835 |
| 162 | Ga0466719_239456 | 3300042606 | Unclassified | 1936 |
| 163 | Ga0466719_378974 | 3300042606 | Bacteria | 9253 |
| 164 | Ga0466720_144118 | 3300042607 | Bacteria | 25436 |
| 165 | Ga0466722_035110 | 3300042609 | Bacteria | 9567 |
| 166 | Ga0123353_10008746 | 3300010167 | Bacteria | 13871 |
| 167 | Ga0123353_10169687 | 3300010167 | Bacteria | 3465 |
| 168 | Ga0123353_10530734 | 3300010167 | Bacteria | 1704 |
| 169 | Ga0466731_082966 | 3300042622 | Bacteria | 2203 |
| 170 | Ga0466702_125101 | 3300042635 | Bacteria | 5591 |
| 171 | Ga0466704_098643 | 3300042643 | Bacteria | 2557 |
| 172 | Ga0466704_194291 | 3300042643 | Unclassified | 3627 |
| 173 | Ga0466709_326410 | 3300042648 | Bacteria | 2149 |
| 174 | Ga0466708_097006 | 3300042652 | Bacteria | 6092 |
| 175 | Ga0466725_343197 | 3300042654 | Unclassified | 7215 |
| 176 | Ga0466656_119156 | 3300042550 | Bacteria | 1365 |
| 177 | Ga0466690_048731 | 3300042590 | Bacteria | 8461 |
| 178 | Ga0466691_064109 | 3300042593 | Bacteria | 2614 |
| 179 | Ga0466691_146718 | 3300042593 | Unclassified | 3053 |
| 180 | Ga0466694_373612 | 3300042594 | Bacteria | 2059 |
| 181 | Ga0466696_176785 | 3300042596 | Bacteria | 19925 |
| 182 | Ga0466699_053014 | 3300042597 | Bacteria | 15726 |
| 183 | Ga0466699_175396 | 3300042597 | Bacteria | 2676 |
| 184 | Ga0466699_273950 | 3300042597 | Bacteria | 2975 |
| 185 | AustNasuHG_c1011636 | 3300000089 | Bacteria | 3047 |
| 186 | JGI24702J35022_10000367 | 3300002462 | Bacteria | 26825 |
| 187 | JGI24702J35022_10008950 | 3300002462 | Bacteria | 5643 |
| 188 | Ga0072940_1050513 | 3300005200 | Bacteria | 9126 |
| 189 | Ga0466705_073840 | 3300042612 | Bacteria | 2550 |
| 190 | Ga0466712_235554 | 3300042614 | Bacteria | 5243 |
| 191 | Ga0466711_303594 | 3300042615 | Bacteria | 7574 |
| 192 | Ga0466715_234926 | 3300042616 | Bacteria | 12238 |
| 193 | Ga0466726_167869 | 3300042619 | Bacteria | 2392 |
| 194 | Ga0466728_241233 | 3300042620 | Bacteria | 1312 |
| 195 | Ga0466728_330118 | 3300042620 | Bacteria | 2444 |
| 196 | Ga0466706_024227 | 3300042599 | Bacteria | 2086 |
| 197 | Ga0466707_140733 | 3300042601 | Bacteria | 6395 |
| 198 | Ga0466707_187385 | 3300042601 | Bacteria | 22990 |
| 199 | Ga0466716_067248 | 3300042605 | Bacteria | 4039 |
| 200 | Ga0466716_171021 | 3300042605 | Bacteria | 5352 |
| 201 | Ga0466719_126760 | 3300042606 | Bacteria | 30509 |
| 202 | Ga0466720_027153 | 3300042607 | Bacteria | 13715 |
| 203 | Ga0123356_10064205 | 3300010049 | Bacteria | 3432 |
| 204 | Ga0123356_10068269 | 3300010049 | Bacteria | 3330 |
| 205 | Ga0123356_10482783 | 3300010049 | Bacteria | 1392 |
| 206 | Ga0466731_021178 | 3300042622 | Bacteria | 1317 |
| 207 | Ga0466731_426027 | 3300042622 | Bacteria | 2116 |
| 208 | Ga0466702_232704 | 3300042635 | Unclassified | 2361 |
| 209 | Ga0466703_182941 | 3300042636 | Bacteria | 21148 |
| 210 | Ga0466703_188942 | 3300042636 | Bacteria | 3444 |
| 211 | Ga0466703_239645 | 3300042636 | Bacteria | 8010 |
| 212 | Ga0466704_216804 | 3300042643 | Bacteria | 12927 |
| 213 | Ga0466704_363584 | 3300042643 | Bacteria | 4278 |
| 214 | Ga0466704_466222 | 3300042643 | Bacteria | 45364 |
| 215 | Ga0466709_029560 | 3300042648 | Bacteria | 15471 |
| 216 | Ga0466709_130631 | 3300042648 | Bacteria | 8981 |
| 217 | Ga0466725_205215 | 3300042654 | Bacteria | 1936 |
| 218 | Ga0466692_069201 | 3300042591 | Bacteria | 165617 |
| 219 | Ga0466694_280127 | 3300042594 | Bacteria | 1264 |
| 220 | Ga0466696_026717 | 3300042596 | Bacteria | 3521 |
| 221 | Ga0466699_185635 | 3300042597 | Bacteria | 14924 |
| 222 | AustNasuHG_c1000106 | 3300000089 | Bacteria | 25236 |
| 223 | AustNasuHG_c1000261 | 3300000089 | Bacteria | 17949 |
| 224 | JGI24698J34947_10005111 | 3300002449 | Bacteria | 7189 |
| 225 | Ga0466697_182033 | 3300042611 | Bacteria | 1346 |
| 226 | Ga0466705_250409 | 3300042612 | Bacteria | 2646 |
| 227 | Ga0466712_030681 | 3300042614 | Bacteria | 58628 |
| 228 | Ga0466712_227094 | 3300042614 | Bacteria | 39101 |
| 229 | Ga0466715_189379 | 3300042616 | Bacteria | 17590 |
| 230 | Ga0466718_015822 | 3300042617 | Bacteria | 9482 |
| 231 | Ga0466723_011379 | 3300042618 | Bacteria | 6701 |
| 232 | Ga0466723_131066 | 3300042618 | Bacteria | 51139 |
| 233 | Ga0466726_111742 | 3300042619 | Bacteria | 7247 |
| 234 | Ga0466726_313520 | 3300042619 | Bacteria | 2256 |
| 235 | Ga0466726_386039 | 3300042619 | Bacteria | 1402 |
| 236 | Ga0466728_360705 | 3300042620 | Bacteria | 4160 |
| 237 | Ga0466729_029115 | 3300042621 | Bacteria | 4148 |
| 238 | Ga0466729_061284 | 3300042621 | Bacteria | 3137 |
| 239 | Ga0466707_079109 | 3300042601 | Bacteria | 1410 |
| 240 | Ga0466716_144611 | 3300042605 | Bacteria | 3197 |
| 241 | Ga0466719_138499 | 3300042606 | Bacteria | 3667 |
| 242 | Ga0466720_037163 | 3300042607 | Bacteria | 5701 |
| 243 | Ga0466720_178749 | 3300042607 | Bacteria | 1774 |
| 244 | Ga0466722_081903 | 3300042609 | Bacteria | 33985 |
| 245 | Ga0123353_10022089 | 3300010167 | Bacteria | 9575 |
| 246 | Ga0123353_10155086 | 3300010167 | Bacteria | 3652 |
| 247 | Ga0123353_10296540 | 3300010167 | Bacteria | 2471 |
| 248 | Ga0123354_10008024 | 3300010882 | Bacteria | 16017 |
| 249 | Ga0123354_10248893 | 3300010882 | Bacteria | 1807 |
| 250 | Ga0466703_191139 | 3300042636 | Bacteria | 1799 |
| 251 | Ga0466704_099199 | 3300042643 | Unclassified | 3127 |
| 252 | Ga0466704_178482 | 3300042643 | Unclassified | 3618 |
| 253 | Ga0466708_075305 | 3300042652 | Bacteria | 13330 |
| 254 | Ga0466708_304569 | 3300042652 | Bacteria | 2264 |
| 255 | Ga0466708_454366 | 3300042652 | Bacteria | 3435 |
| 256 | Ga0456237_0011823 | 3300041968 | Bacteria | 1271 |
| 257 | Ga0466690_090343 | 3300042590 | Bacteria | 10868 |
| 258 | Ga0466690_203975 | 3300042590 | Bacteria | 9971 |
| 259 | Ga0466693_145825 | 3300042592 | Bacteria | 23378 |
| 260 | Ga0466695_234247 | 3300042595 | Bacteria | 1251 |
| 261 | Ga0466696_135420 | 3300042596 | Bacteria | 3530 |
| 262 | JGI24702J35022_10004605 | 3300002462 | Bacteria | 8176 |
| 263 | JGI24705J35276_12225180 | 3300002504 | Bacteria | 2690 |
| 264 | JGI24697J35500_11271052 | 3300002507 | Bacteria | 4387 |
| 265 | JGI24696J40584_12960716 | 3300002834 | Bacteria | 8166 |
| 266 | Ga0466705_304497 | 3300042612 | Unclassified | 14150 |
| 267 | Ga0466733_141671 | 3300042659 | Bacteria | 5344 |
| 268 | Ga0466733_217443 | 3300042659 | Bacteria | 1193 |
| 269 | Ga0466712_043625 | 3300042614 | Bacteria | 22329 |
| 270 | Ga0466712_271848 | 3300042614 | Bacteria | 18335 |
| 271 | Ga0466715_120690 | 3300042616 | Bacteria | 9019 |
| 272 | Ga0466726_017697 | 3300042619 | Bacteria | 16163 |
| 273 | Ga0466726_276552 | 3300042619 | Bacteria | 3163 |
| 274 | Ga0466728_084744 | 3300042620 | Bacteria | 6408 |
| 275 | Ga0466728_351434 | 3300042620 | Bacteria | 2864 |
| 276 | Ga0466707_007102 | 3300042601 | Bacteria | 2898 |
| 277 | Ga0466707_114935 | 3300042601 | Bacteria | 24732 |
| 278 | Ga0466707_351640 | 3300042601 | Unclassified | 3757 |
| 279 | Ga0466714_168250 | 3300042603 | Bacteria | 2994 |
| 280 | Ga0466717_076244 | 3300042604 | Bacteria | 1962 |
| 281 | Ga0466717_157578 | 3300042604 | Bacteria | 1456 |
| 282 | Ga0466716_140413 | 3300042605 | Bacteria | 7255 |
| 283 | Ga0466719_245081 | 3300042606 | Bacteria | 17816 |
| 284 | Ga0466719_396572 | 3300042606 | Unclassified | 1959 |
| 285 | Ga0466720_045720 | 3300042607 | Bacteria | 5503 |
| 286 | Ga0466720_167876 | 3300042607 | Bacteria | 6291 |
| 287 | Ga0466720_191196 | 3300042607 | Bacteria | 4804 |
| 288 | Ga0123353_10325042 | 3300010167 | Bacteria | 2332 |
| 289 | Ga0466735_236047 | 3300042624 | Bacteria | 12890 |
| 290 | Ga0466702_250280 | 3300042635 | Bacteria | 23290 |
| 291 | Ga0466703_134364 | 3300042636 | Bacteria | 6632 |
| 292 | Ga0466709_159481 | 3300042648 | Bacteria | 3159 |
| 293 | Ga0466709_222586 | 3300042648 | Unclassified | 2247 |
| 294 | Ga0466708_051842 | 3300042652 | Bacteria | 13122 |
| 295 | Ga0466708_073929 | 3300042652 | Bacteria | 19339 |
| 296 | Ga0264413_110605 | 3300024493 | Bacteria | 7648 |
| 297 | Ga0466690_189737 | 3300042590 | Bacteria | 2477 |
| 298 | Ga0466690_241194 | 3300042590 | Bacteria | 2914 |
| 299 | Ga0466691_198559 | 3300042593 | Bacteria | 13562 |
| 300 | Ga0466691_199472 | 3300042593 | Bacteria | 1983 |
| 301 | Ga0466699_130593 | 3300042597 | Bacteria | 1638 |
| 302 | JGI24698J34947_10011943 | 3300002449 | Bacteria | 4768 |
| 303 | JGI24695J34938_10000741 | 3300002450 | Bacteria | 30647 |
| 304 | JGI24695J34938_10002296 | 3300002450 | Bacteria | 14738 |
| 305 | JGI24695J34938_10005341 | 3300002450 | Bacteria | 8035 |
| 306 | JGI24699J35502_11097733 | 3300002509 | Unclassified | 2277 |
| 307 | Ga0072941_1005931 | 3300005201 | Bacteria | 16771 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02615 | Ldh_2 | Malate/L-lactate dehydrogenase | 61 | 405 | 0.98 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02615 | GO:0016491 | oxidoreductase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.