Protein Family IF04906
Metagenome
Isolate
190
Members
44
Samples
184
Scaffolds
221.69
Avg Length
Representative Sequence
- ID
- 3300042593|Ga0466691_114084|Ga0466691_114084_931_1719
- Length
- 262 aa
- Sequence
- MVSVVFYSPADWGSHNNHIIFLVVIGYGIFISILLGAINIILRFFDILFSCIAIIILFPLVIPVMIVLKLTGEHYIFYTQVRIGKHNRPFKVLKFATMLRDSPNLPGGLITVPDDPRLLPLGKFLRKTKINELPQLLNILIGQMSIVGYRPFVEKHYTLYSDAVKNKIKTIKPGLTGIGSIIFRDEEEILHSVSGRDNFHDKIITPYKGLLECWYVENQSVKNYFLIIFCTFLSVLNIKKSIWKKLFVNLPDMPLELISYLE
Sample Types
Isolate
2.6%
Metagenome
97.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
31.0%
Termitidae
31.0%
Unclassified
16.7%
Termopsidae
9.5%
Rhinotermitidae
7.1%
Passalidae
2.4%
Hodotermitidae
2.4%
Taxonomy
Archaea
1
Bacteria
167
Eukaryota
0
Viruses
0
Unclassified
22
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 2 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 10 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 11 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 12 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 13 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 14 | 2772190889 | Unclassified Elusimicrobia Cu122P5_bin43 | Isolate | Unclassified |
| 15 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 16 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 17 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 18 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 19 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 20 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 21 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 22 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 23 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 24 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 25 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 26 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 27 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 28 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 29 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 30 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 31 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 32 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 33 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 34 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 35 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 36 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 37 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 38 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 39 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 40 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 41 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 42 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 43 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 44 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_161373 | 3300042612 | Bacteria | 4527 |
| 2 | Ga0466733_100573 | 3300042659 | Bacteria | 1417 |
| 3 | Ga0466733_132668 | 3300042659 | Bacteria | 4891 |
| 4 | Ga0466705_413192 | 3300042612 | Bacteria | 4412 |
| 5 | Ga0466711_099002 | 3300042615 | Bacteria | 3660 |
| 6 | Ga0466711_274969 | 3300042615 | Bacteria | 7158 |
| 7 | Ga0466726_296985 | 3300042619 | Bacteria | 1179 |
| 8 | Ga0466700_443729 | 3300042600 | Bacteria | 10791 |
| 9 | Ga0466722_200251 | 3300042609 | Bacteria | 6261 |
| 10 | Ga0466698_290938 | 3300042610 | Bacteria | 3081 |
| 11 | Ga0466691_027292 | 3300042593 | Bacteria | 9433 |
| 12 | Ga0466691_029066 | 3300042593 | Bacteria | 9795 |
| 13 | Ga0466696_016290 | 3300042596 | Bacteria | 1635 |
| 14 | Ga0466696_375149 | 3300042596 | Bacteria | 4589 |
| 15 | Ga0466703_003296 | 3300042636 | Bacteria | 4338 |
| 16 | Ga0466704_285737 | 3300042643 | Bacteria | 37024 |
| 17 | Ga0466708_005335 | 3300042652 | Bacteria | 15843 |
| 18 | Ga0466708_050624 | 3300042652 | Bacteria | 4329 |
| 19 | Ga0466708_234738 | 3300042652 | Bacteria | 19411 |
| 20 | JGI24695J34938_10001261 | 3300002450 | Bacteria | 22261 |
| 21 | Ga0466705_362599 | 3300042612 | Bacteria | 12960 |
| 22 | Ga0466711_207141 | 3300042615 | Unclassified | 1233 |
| 23 | Ga0466715_285939 | 3300042616 | Bacteria | 20907 |
| 24 | Ga0466715_488310 | 3300042616 | Bacteria | 1076 |
| 25 | Ga0466726_219217 | 3300042619 | Bacteria | 1213 |
| 26 | Ga0466707_307614 | 3300042601 | Bacteria | 54795 |
| 27 | Ga0466716_093753 | 3300042605 | Bacteria | 6300 |
| 28 | Ga0466716_504306 | 3300042605 | Bacteria | 2306 |
| 29 | Ga0466691_226886 | 3300042593 | Bacteria | 3366 |
| 30 | Ga0466696_032746 | 3300042596 | Bacteria | 8203 |
| 31 | Ga0123353_10157701 | 3300010167 | Bacteria | 3615 |
| 32 | Ga0466703_062600 | 3300042636 | Bacteria | 2161 |
| 33 | Ga0466703_082938 | 3300042636 | Bacteria | 3980 |
| 34 | Ga0466704_260353 | 3300042643 | Bacteria | 2538 |
| 35 | Ga0466709_252434 | 3300042648 | Unclassified | 2623 |
| 36 | Ga0466727_035064 | 3300042655 | Bacteria | 3358 |
| 37 | 2227305242 | 2225789004 | Bacteria | 1215 |
| 38 | 2227672671 | 2225789004 | Bacteria | 1889 |
| 39 | JGI24695J34938_10000836 | 3300002450 | Bacteria | 28563 |
| 40 | Ga0068302_10911956 | 3300005071 | Bacteria | 1262 |
| 41 | Ga0466705_007263 | 3300042612 | Bacteria | 40751 |
| 42 | Ga0466705_214376 | 3300042612 | Bacteria | 3079 |
| 43 | Ga0466705_358808 | 3300042612 | Bacteria | 1605 |
| 44 | Ga0466705_441567 | 3300042612 | Bacteria | 3318 |
| 45 | Ga0466705_471314 | 3300042612 | Bacteria | 1214 |
| 46 | Ga0466705_485387 | 3300042612 | Bacteria | 4166 |
| 47 | Ga0466711_043169 | 3300042615 | Bacteria | 4174 |
| 48 | Ga0466711_495588 | 3300042615 | Bacteria | 3351 |
| 49 | Ga0466711_496986 | 3300042615 | Bacteria | 1056 |
| 50 | Ga0466715_198162 | 3300042616 | Unclassified | 2322 |
| 51 | Ga0466715_198614 | 3300042616 | Bacteria | 2844 |
| 52 | Ga0466726_006211 | 3300042619 | Unclassified | 1040 |
| 53 | Ga0466726_152778 | 3300042619 | Unclassified | 1749 |
| 54 | Ga0466726_192129 | 3300042619 | Bacteria | 2541 |
| 55 | Ga0466726_205173 | 3300042619 | Bacteria | 2571 |
| 56 | Ga0466726_259257 | 3300042619 | Bacteria | 2239 |
| 57 | Ga0466726_321279 | 3300042619 | Bacteria | 1345 |
| 58 | Ga0466728_095902 | 3300042620 | Bacteria | 11591 |
| 59 | Ga0466728_124958 | 3300042620 | Bacteria | 1762 |
| 60 | Ga0466728_207424 | 3300042620 | Bacteria | 17195 |
| 61 | Ga0466707_150895 | 3300042601 | Unclassified | 1163 |
| 62 | Ga0466707_339723 | 3300042601 | Bacteria | 5526 |
| 63 | Ga0466716_041358 | 3300042605 | Unclassified | 3358 |
| 64 | Ga0466722_137793 | 3300042609 | Bacteria | 3438 |
| 65 | Ga0466722_242564 | 3300042609 | Bacteria | 2469 |
| 66 | Ga0123353_11140985 | 3300010167 | Unclassified | 1030 |
| 67 | Ga0466735_005312 | 3300042624 | Unclassified | 7505 |
| 68 | Ga0466735_110289 | 3300042624 | Bacteria | 12453 |
| 69 | Ga0466735_155327 | 3300042624 | Bacteria | 17241 |
| 70 | Ga0466704_374712 | 3300042643 | Bacteria | 4733 |
| 71 | Ga0466704_541526 | 3300042643 | Bacteria | 2254 |
| 72 | Ga0466708_133192 | 3300042652 | Bacteria | 9346 |
| 73 | Ga0466708_452125 | 3300042652 | Bacteria | 3431 |
| 74 | Ga0466727_299985 | 3300042655 | Bacteria | 1226 |
| 75 | JGI24695J34938_10000176 | 3300002450 | Bacteria | 59497 |
| 76 | Ga0466705_528068 | 3300042612 | Bacteria | 1446 |
| 77 | Ga0466715_200507 | 3300042616 | Unclassified | 2479 |
| 78 | Ga0466715_207591 | 3300042616 | Bacteria | 15197 |
| 79 | Ga0466715_386963 | 3300042616 | Bacteria | 7036 |
| 80 | Ga0466726_017843 | 3300042619 | Bacteria | 4522 |
| 81 | Ga0466726_292952 | 3300042619 | Bacteria | 2364 |
| 82 | Ga0466726_293877 | 3300042619 | Bacteria | 2224 |
| 83 | Ga0466726_302180 | 3300042619 | Unclassified | 3397 |
| 84 | Ga0466714_103269 | 3300042603 | Bacteria | 3942 |
| 85 | Ga0466691_114084 | 3300042593 | Bacteria | 2370 |
| 86 | Ga0466696_178102 | 3300042596 | Bacteria | 1604 |
| 87 | Ga0123353_11281272 | 3300010167 | Unclassified | 953 |
| 88 | Ga0466704_038305 | 3300042643 | Bacteria | 1242 |
| 89 | Ga0466704_230463 | 3300042643 | Bacteria | 7599 |
| 90 | Ga0466704_231109 | 3300042643 | Bacteria | 12291 |
| 91 | Ga0466704_381790 | 3300042643 | Bacteria | 14332 |
| 92 | Ga0466708_412241 | 3300042652 | Bacteria | 3125 |
| 93 | Ga0466727_195876 | 3300042655 | Bacteria | 1200 |
| 94 | Ga0466727_257496 | 3300042655 | Bacteria | 10064 |
| 95 | JGI24695J34938_10002379 | 3300002450 | Bacteria | 14472 |
| 96 | Ga0466705_223533 | 3300042612 | Bacteria | 9670 |
| 97 | Ga0466733_003496 | 3300042659 | Bacteria | 27941 |
| 98 | Ga0466733_164672 | 3300042659 | Archaea | 2988 |
| 99 | Ga0466711_129434 | 3300042615 | Bacteria | 1382 |
| 100 | Ga0466711_377011 | 3300042615 | Bacteria | 37393 |
| 101 | Ga0466715_049034 | 3300042616 | Bacteria | 21580 |
| 102 | Ga0466726_104369 | 3300042619 | Bacteria | 3307 |
| 103 | Ga0466726_167685 | 3300042619 | Unclassified | 3066 |
| 104 | Ga0466726_353334 | 3300042619 | Bacteria | 1828 |
| 105 | Ga0466726_359816 | 3300042619 | Bacteria | 1624 |
| 106 | Ga0466728_019460 | 3300042620 | Bacteria | 3717 |
| 107 | Ga0466707_282806 | 3300042601 | Bacteria | 1078 |
| 108 | Ga0466716_151029 | 3300042605 | Bacteria | 9508 |
| 109 | Ga0466692_024352 | 3300042591 | Bacteria | 3960 |
| 110 | Ga0466692_169574 | 3300042591 | Bacteria | 4541 |
| 111 | Ga0466691_006968 | 3300042593 | Unclassified | 1537 |
| 112 | Ga0466696_067939 | 3300042596 | Bacteria | 4402 |
| 113 | Ga0123355_10141635 | 3300009826 | Bacteria | 3678 |
| 114 | Ga0466703_027689 | 3300042636 | Bacteria | 31024 |
| 115 | Ga0466727_329876 | 3300042655 | Bacteria | 1580 |
| 116 | JGI24695J34938_10013007 | 3300002450 | Bacteria | 4387 |
| 117 | JGI24695J34938_10030058 | 3300002450 | Bacteria | 2534 |
| 118 | Ga0466705_286694 | 3300042612 | Bacteria | 89956 |
| 119 | Ga0466705_518159 | 3300042612 | Bacteria | 1697 |
| 120 | Ga0466711_025416 | 3300042615 | Bacteria | 2025 |
| 121 | Ga0466715_185952 | 3300042616 | Bacteria | 2632 |
| 122 | Ga0466723_185509 | 3300042618 | Bacteria | 5951 |
| 123 | Ga0466726_179012 | 3300042619 | Unclassified | 3051 |
| 124 | Ga0466726_218592 | 3300042619 | Bacteria | 6588 |
| 125 | Ga0466716_457760 | 3300042605 | Unclassified | 2448 |
| 126 | Ga0466719_091883 | 3300042606 | Bacteria | 1264 |
| 127 | Ga0456237_0022148 | 3300041968 | Bacteria | 875 |
| 128 | Ga0466656_233754 | 3300042550 | Bacteria | 1819 |
| 129 | Ga0466657_336517 | 3300042582 | Bacteria | 6370 |
| 130 | Ga0466696_363945 | 3300042596 | Unclassified | 1068 |
| 131 | Ga0466703_083667 | 3300042636 | Bacteria | 2302 |
| 132 | Ga0466704_071260 | 3300042643 | Bacteria | 7074 |
| 133 | Ga0466704_540450 | 3300042643 | Bacteria | 2769 |
| 134 | Ga0466708_350166 | 3300042652 | Bacteria | 1011 |
| 135 | Ga0466727_196053 | 3300042655 | Bacteria | 1185 |
| 136 | Ga0466727_333892 | 3300042655 | Bacteria | 1256 |
| 137 | Ga0466711_185522 | 3300042615 | Bacteria | 1489 |
| 138 | Ga0466711_253824 | 3300042615 | Bacteria | 4471 |
| 139 | Ga0466715_490650 | 3300042616 | Bacteria | 2447 |
| 140 | Ga0466723_029079 | 3300042618 | Bacteria | 1763 |
| 141 | Ga0466726_138016 | 3300042619 | Unclassified | 2906 |
| 142 | Ga0466726_158241 | 3300042619 | Bacteria | 1716 |
| 143 | Ga0466726_205975 | 3300042619 | Bacteria | 5828 |
| 144 | Ga0466701_101273 | 3300042598 | Bacteria | 13307 |
| 145 | Ga0466706_200370 | 3300042599 | Unclassified | 1519 |
| 146 | Ga0466707_355696 | 3300042601 | Bacteria | 3652 |
| 147 | Ga0466714_102141 | 3300042603 | Bacteria | 2712 |
| 148 | Ga0466714_153348 | 3300042603 | Bacteria | 1045 |
| 149 | Ga0466719_473352 | 3300042606 | Bacteria | 1081 |
| 150 | Ga0466719_493492 | 3300042606 | Unclassified | 1439 |
| 151 | Ga0466719_563885 | 3300042606 | Bacteria | 16233 |
| 152 | Ga0264413_130353 | 3300024493 | Bacteria | 5421 |
| 153 | Ga0264413_157715 | 3300024493 | Bacteria | 1182 |
| 154 | Ga0466691_055382 | 3300042593 | Bacteria | 2140 |
| 155 | Ga0466691_152738 | 3300042593 | Bacteria | 14674 |
| 156 | Ga0123355_10000009 | 3300009826 | Bacteria | 191038 |
| 157 | Ga0123355_10000055 | 3300009826 | Bacteria | 117901 |
| 158 | Ga0123356_10174189 | 3300010049 | Bacteria | 2166 |
| 159 | Ga0123353_11907310 | 3300010167 | Unclassified | 733 |
| 160 | Ga0466704_504920 | 3300042643 | Bacteria | 4248 |
| 161 | Ga0466709_251493 | 3300042648 | Bacteria | 7600 |
| 162 | JGI24695J34938_10044371 | 3300002450 | Bacteria | 1977 |
| 163 | JGI24695J34938_10057987 | 3300002450 | Bacteria | 1662 |
| 164 | Ga0466705_082605 | 3300042612 | Bacteria | 7567 |
| 165 | Ga0466705_265702 | 3300042612 | Bacteria | 3878 |
| 166 | Ga0466733_083575 | 3300042659 | Bacteria | 3808 |
| 167 | Ga0466705_504518 | 3300042612 | Bacteria | 2508 |
| 168 | Ga0466705_506477 | 3300042612 | Bacteria | 8544 |
| 169 | Ga0466711_419670 | 3300042615 | Bacteria | 4037 |
| 170 | Ga0466723_019458 | 3300042618 | Bacteria | 7399 |
| 171 | Ga0466723_031966 | 3300042618 | Bacteria | 7558 |
| 172 | Ga0466728_377724 | 3300042620 | Bacteria | 5603 |
| 173 | Ga0466713_150002 | 3300042602 | Bacteria | 1434 |
| 174 | Ga0466722_040615 | 3300042609 | Bacteria | 4364 |
| 175 | Ga0466693_123745 | 3300042592 | Bacteria | 1340 |
| 176 | Ga0466691_136287 | 3300042593 | Bacteria | 10374 |
| 177 | Ga0466691_223218 | 3300042593 | Bacteria | 10425 |
| 178 | Ga0466696_011714 | 3300042596 | Bacteria | 1098 |
| 179 | Ga0466696_098159 | 3300042596 | Bacteria | 13667 |
| 180 | Ga0123354_10000040 | 3300010882 | Bacteria | 96699 |
| 181 | Ga0466708_117608 | 3300042652 | Unclassified | 2059 |
| 182 | Ga0466727_235903 | 3300042655 | Bacteria | 1803 |
| 183 | JGI24695J34938_10001570 | 3300002450 | Bacteria | 19230 |
| 184 | Ga0072941_1036413 | 3300005201 | Bacteria | 12515 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02397 | Bac_transf | Bacterial sugar transferase | 43 | 236 | 0.91 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.