Protein Family IF04844
Metagenome
Isolate
115
Members
47
Samples
111
Scaffolds
381.68
Avg Length
Representative Sequence
- ID
- 3300042593|Ga0466691_030326|Ga0466691_030326_3722_5017
- Length
- 431 aa
- Sequence
- MGDIGGWFPFIRYLQKHSRPCRMGYMVVSATSHVKKLHVPVSPKNPSLDPAALNFDLFNDPCENGDYLTKQIITYIGNKRSLLNFITKGIHIVQKRLQKDKLDIFDVFTGSGIVARHCKQFSHLLMVNDLEKYAAITGECYLSNKDELNMPLLQDMYHGLLSDAANKPLREGIIAQLYSPKNDNNIQKDERVFYTRRNAMYIDTMRNLIDTVPAQYQKYFLAPLIAEASIHANTSGVFKGFHKNKETGIGQFGGSNSDALLRIKGNITLPFPVFSSFNCAYQVYNGDSNVIIKEAPEVDLAYLDPPYNQHPYGSNYFMLSLIFENKHPESVSKISGIPDNWNRSAYNKKQCAYQTFADLVAAIKAKFVLISFNSEGFVSLEEMKAMLKKMGKVQVLETTYNTFRGCRNLSRLAEQGARDIHITEYLYLLEK
Sample Types
Isolate
3.5%
Metagenome
96.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.4%
Kalotermitidae
28.9%
Unclassified
11.1%
Rhinotermitidae
6.7%
Termopsidae
6.7%
Hodotermitidae
2.2%
Taxonomy
Archaea
1
Bacteria
109
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 2 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 3 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 4 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 5 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 6 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 7 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 8 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 9 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 10 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 11 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 12 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 13 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 14 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 15 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 16 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 17 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 18 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 19 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 20 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 21 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 22 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 23 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 24 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 25 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 26 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 27 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 28 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 29 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 30 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 31 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 32 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 33 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 34 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 35 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 36 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 37 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 38 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 39 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 40 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 41 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 42 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 43 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 44 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 45 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 46 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 47 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0264413_130810 | 3300024493 | Bacteria | 2394 |
| 2 | Ga0466693_437286 | 3300042592 | Bacteria | 12962 |
| 3 | Ga0466696_290196 | 3300042596 | Bacteria | 21334 |
| 4 | Ga0466706_031499 | 3300042599 | Unclassified | 1695 |
| 5 | Ga0466700_036147 | 3300042600 | Bacteria | 1395 |
| 6 | Ga0466720_137952 | 3300042607 | Bacteria | 9817 |
| 7 | JGI24695J34938_10062658 | 3300002450 | Bacteria | 1578 |
| 8 | Ga0072940_1007528 | 3300005200 | Bacteria | 3081 |
| 9 | Ga0072941_1049711 | 3300005201 | Bacteria | 2389 |
| 10 | Ga0466708_143322 | 3300042652 | Bacteria | 8097 |
| 11 | Ga0466728_159705 | 3300042620 | Bacteria | 8916 |
| 12 | Ga0466732_025050 | 3300042656 | Bacteria | 1486 |
| 13 | Ga0466732_205099 | 3300042656 | Bacteria | 2245 |
| 14 | Ga0264413_120702 | 3300024493 | Bacteria | 4058 |
| 15 | Ga0264413_137642 | 3300024493 | Bacteria | 1614 |
| 16 | Ga0466690_398437 | 3300042590 | Bacteria | 55593 |
| 17 | Ga0466692_063712 | 3300042591 | Bacteria | 4397 |
| 18 | Ga0466692_129350 | 3300042591 | Bacteria | 7149 |
| 19 | Ga0466693_361907 | 3300042592 | Bacteria | 1410 |
| 20 | Ga0466694_273037 | 3300042594 | Bacteria | 21528 |
| 21 | Ga0466716_091781 | 3300042605 | Unclassified | 2260 |
| 22 | Ga0466720_013838 | 3300042607 | Bacteria | 5262 |
| 23 | Ga0466722_082751 | 3300042609 | Bacteria | 2327 |
| 24 | AustNasuHG_c1000634 | 3300000089 | Bacteria | 12458 |
| 25 | JGI24698J34947_10000395 | 3300002449 | Bacteria | 19776 |
| 26 | JGI24698J34947_10003303 | 3300002449 | Bacteria | 8742 |
| 27 | JGI24695J34938_10000310 | 3300002450 | Bacteria | 48067 |
| 28 | JGI24695J34938_10059543 | 3300002450 | Bacteria | 1633 |
| 29 | Ga0072940_1003196 | 3300005200 | Bacteria | 2636 |
| 30 | Ga0466705_150908 | 3300042612 | Bacteria | 2372 |
| 31 | Ga0466704_434098 | 3300042643 | Bacteria | 82573 |
| 32 | Ga0466711_403322 | 3300042615 | Bacteria | 3214 |
| 33 | Ga0466718_064135 | 3300042617 | Bacteria | 7291 |
| 34 | Ga0466718_067474 | 3300042617 | Bacteria | 6564 |
| 35 | Ga0466732_026722 | 3300042656 | Bacteria | 1531 |
| 36 | Ga0264413_121550 | 3300024493 | Bacteria | 3044 |
| 37 | Ga0466692_068312 | 3300042591 | Bacteria | 12471 |
| 38 | Ga0466693_105231 | 3300042592 | Archaea | 2541 |
| 39 | Ga0466691_030326 | 3300042593 | Bacteria | 10108 |
| 40 | Ga0466695_263404 | 3300042595 | Bacteria | 6949 |
| 41 | Ga0466720_011798 | 3300042607 | Bacteria | 4300 |
| 42 | AustNasuHG_c1007413 | 3300000089 | Bacteria | 3909 |
| 43 | AustNasuHG_c1018169 | 3300000089 | Bacteria | 2325 |
| 44 | Ga0072941_1040887 | 3300005201 | Bacteria | 12276 |
| 45 | Ga0466703_260563 | 3300042636 | Bacteria | 2406 |
| 46 | Ga0466694_082463 | 3300042594 | Bacteria | 2962 |
| 47 | Ga0466696_070678 | 3300042596 | Bacteria | 3216 |
| 48 | Ga0123356_10000080 | 3300010049 | Bacteria | 102921 |
| 49 | Ga0466719_297244 | 3300042606 | Bacteria | 4472 |
| 50 | Ga0466720_011212 | 3300042607 | Bacteria | 3532 |
| 51 | Ga0466720_026649 | 3300042607 | Bacteria | 9069 |
| 52 | Ga0466720_116617 | 3300042607 | Bacteria | 1613 |
| 53 | Ga0466722_217006 | 3300042609 | Bacteria | 5086 |
| 54 | JGI24702J35022_10002228 | 3300002462 | Bacteria | 11922 |
| 55 | JGI24700J35501_10930309 | 3300002508 | Bacteria | 12896 |
| 56 | Ga0466731_402833 | 3300042622 | Bacteria | 5485 |
| 57 | Ga0466712_245897 | 3300042614 | Bacteria | 2095 |
| 58 | Ga0466718_096891 | 3300042617 | Bacteria | 8564 |
| 59 | Ga0466732_092230 | 3300042656 | Bacteria | 3867 |
| 60 | Ga0456237_0000249 | 3300041968 | Unclassified | 7863 |
| 61 | Ga0466692_040247 | 3300042591 | Bacteria | 4645 |
| 62 | Ga0466693_146051 | 3300042592 | Bacteria | 1675 |
| 63 | Ga0466695_317830 | 3300042595 | Bacteria | 1353 |
| 64 | Ga0466720_078349 | 3300042607 | Bacteria | 6897 |
| 65 | Ga0466721_341331 | 3300042608 | Bacteria | 4348 |
| 66 | AustNasuHG_c1017700 | 3300000089 | Bacteria | 2365 |
| 67 | JGI24695J34938_10000145 | 3300002450 | Bacteria | 64417 |
| 68 | JGI24695J34938_10004652 | 3300002450 | Bacteria | 8913 |
| 69 | Ga0466731_117470 | 3300042622 | Bacteria | 6471 |
| 70 | Ga0466703_114605 | 3300042636 | Bacteria | 15918 |
| 71 | Ga0466712_006437 | 3300042614 | Bacteria | 4598 |
| 72 | Ga0466715_393488 | 3300042616 | Bacteria | 4466 |
| 73 | Ga0466726_294095 | 3300042619 | Bacteria | 2553 |
| 74 | Ga0466732_134714 | 3300042656 | Bacteria | 8947 |
| 75 | Ga0456237_0000198 | 3300041968 | Bacteria | 8832 |
| 76 | Ga0466690_247532 | 3300042590 | Bacteria | 3802 |
| 77 | Ga0466691_011152 | 3300042593 | Bacteria | 8405 |
| 78 | Ga0466691_039460 | 3300042593 | Bacteria | 45742 |
| 79 | Ga0466707_229600 | 3300042601 | Bacteria | 5341 |
| 80 | Ga0466719_029737 | 3300042606 | Bacteria | 25830 |
| 81 | JGI24695J34938_10008725 | 3300002450 | Unclassified | 5748 |
| 82 | JGI24702J35022_10000021 | 3300002462 | Bacteria | 63249 |
| 83 | Ga0466727_050276 | 3300042655 | Bacteria | 17589 |
| 84 | Ga0466718_050777 | 3300042617 | Bacteria | 1402 |
| 85 | Ga0264413_121072 | 3300024493 | Bacteria | 1820 |
| 86 | Ga0466656_385393 | 3300042550 | Bacteria | 2254 |
| 87 | Ga0466690_105069 | 3300042590 | Bacteria | 3323 |
| 88 | Ga0466692_051135 | 3300042591 | Bacteria | 5371 |
| 89 | Ga0466692_119867 | 3300042591 | Bacteria | 8242 |
| 90 | Ga0466691_226650 | 3300042593 | Bacteria | 2663 |
| 91 | Ga0466720_079251 | 3300042607 | Bacteria | 4567 |
| 92 | JGI24698J34947_10002927 | 3300002449 | Bacteria | 9260 |
| 93 | JGI24698J34947_10016351 | 3300002449 | Unclassified | 4026 |
| 94 | Ga0466711_277329 | 3300042615 | Bacteria | 4618 |
| 95 | Ga0466723_059416 | 3300042618 | Bacteria | 23149 |
| 96 | Ga0264413_130417 | 3300024493 | Bacteria | 1573 |
| 97 | Ga0466690_312032 | 3300042590 | Bacteria | 3283 |
| 98 | Ga0123355_10055782 | 3300009826 | Bacteria | 6397 |
| 99 | Ga0123356_10090479 | 3300010049 | Bacteria | 2914 |
| 100 | Ga0466701_051299 | 3300042598 | Bacteria | 1960 |
| 101 | Ga0466707_132965 | 3300042601 | Bacteria | 35508 |
| 102 | Ga0466720_153489 | 3300042607 | Bacteria | 3455 |
| 103 | Ga0466722_026711 | 3300042609 | Bacteria | 4811 |
| 104 | JGI24698J34947_10029430 | 3300002449 | Bacteria | 2901 |
| 105 | JGI24695J34938_10005784 | 3300002450 | Bacteria | 7608 |
| 106 | JGI24702J35022_10018878 | 3300002462 | Bacteria | 3756 |
| 107 | Ga0072941_1029669 | 3300005201 | Bacteria | 8282 |
| 108 | Ga0072941_1040925 | 3300005201 | Bacteria | 12375 |
| 109 | Ga0466735_232376 | 3300042624 | Bacteria | 2728 |
| 110 | Ga0466711_189418 | 3300042615 | Bacteria | 2923 |
| 111 | Ga0466718_076430 | 3300042617 | Bacteria | 13169 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02086 | MethyltransfD12 | D12 class N6 adenine-specific DNA methyltransferase | 75 | 383 | 0.74 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.