Protein Family IF04809
Metagenome
Isolate
118
Members
61
Samples
109
Scaffolds
339.03
Avg Length
Representative Sequence
- ID
- 3300042592|Ga0466693_422703|Ga0466693_422703_450_1613
- Length
- 387 aa
- Sequence
- MNKNLLSKDESKNRIEPEVFFSFCFGWFYLEKTAFLLGKFNYIKKRKMNKELQFLIYSTPQENVKVDVVVKDETIWLTQKAMAALFGVQVPAVNKHLKNIFEQGELEEKVVVSILEITTPHGAIVGKMQNIETKFYNLDAIISVGYRVNSAKATQFRQWATKVLKEFVQKGFVLDDEWLKQGKSTFGVDYFRELLERVRSIRASERRIWQQITDIFAECSIDYDRNSLTTRDFYAMVQNKFHFAIAGQTAAEIIYTKADRNKENMGLTTWKNSPEGRILKSDITVAKNYLPEKEIKRLERAISGYFDYIEDLIERENTFTMQEFAASVNEFLSFRKYKILNDKGTISKQQADQKAEEEYELFNKTQKIISDFDKAIKKLQQREGVDA
Sample Types
Isolate
7.6%
Metagenome
92.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
46.7%
Kalotermitidae
21.7%
Unclassified
13.3%
Rhinotermitidae
5.0%
Blattidae
5.0%
Termopsidae
5.0%
Hodotermitidae
1.7%
Passalidae
1.7%
Taxonomy
Archaea
1
Bacteria
114
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 4 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 5 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 6 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 7 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 8 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 9 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 10 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 11 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 12 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 13 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 14 | 2940228231 | Anaerovoracaceae bacterium PM5-7 | Isolate | Blattidae |
| 15 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 16 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 17 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 18 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 19 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 20 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 21 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 22 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 23 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 24 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 25 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 26 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 27 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 28 | 2820721785 | Unclassified Fibrobacteres Lab288P1bin58 | Isolate | Unclassified |
| 29 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 30 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 31 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 32 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 33 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 34 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 35 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 36 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 37 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 38 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 39 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 40 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 41 | 2820189034 | Unclassified Planctomycetes Emb289P4bin17 | Isolate | Unclassified |
| 42 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 43 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 44 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 45 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 46 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 47 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 48 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 49 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 50 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 51 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 52 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 53 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 54 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 55 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 56 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 57 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 58 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 59 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 60 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 61 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_191057 | 3300042612 | Bacteria | 21752 |
| 2 | Ga0466715_116445 | 3300042616 | Bacteria | 2701 |
| 3 | Ga0466715_621967 | 3300042616 | Bacteria | 12938 |
| 4 | Ga0466726_099741 | 3300042619 | Bacteria | 3611 |
| 5 | Ga0123355_10000390 | 3300009826 | Bacteria | 56882 |
| 6 | Ga0123355_10027918 | 3300009826 | Bacteria | 9121 |
| 7 | Ga0123356_10000599 | 3300010049 | Bacteria | 39960 |
| 8 | Ga0123353_10527791 | 3300010167 | Bacteria | 1710 |
| 9 | Ga0466702_108026 | 3300042635 | Bacteria | 7443 |
| 10 | Ga0466703_143831 | 3300042636 | Bacteria | 1746 |
| 11 | Ga0466727_208842 | 3300042655 | Bacteria | 1512 |
| 12 | Ga0466701_050984 | 3300042598 | Bacteria | 2426 |
| 13 | Ga0466706_174508 | 3300042599 | Bacteria | 8035 |
| 14 | Ga0466714_094403 | 3300042603 | Bacteria | 5050 |
| 15 | Ga0466719_451636 | 3300042606 | Bacteria | 2197 |
| 16 | JGI24705J35276_12227345 | 3300002504 | Bacteria | 2989 |
| 17 | JGI24699J35502_11120465 | 3300002509 | Bacteria | 3254 |
| 18 | Ga0466690_086078 | 3300042590 | Bacteria | 11747 |
| 19 | Ga0466691_213720 | 3300042593 | Bacteria | 32364 |
| 20 | Ga0466696_187867 | 3300042596 | Bacteria | 1307 |
| 21 | Ga0466705_116153 | 3300042612 | Bacteria | 4287 |
| 22 | Ga0466705_195850 | 3300042612 | Bacteria | 2264 |
| 23 | Ga0466712_027287 | 3300042614 | Bacteria | 10059 |
| 24 | Ga0466728_360215 | 3300042620 | Bacteria | 14391 |
| 25 | Ga0123357_10180947 | 3300009784 | Bacteria | 2462 |
| 26 | Ga0123356_10010688 | 3300010049 | Bacteria | 8986 |
| 27 | Ga0466727_252626 | 3300042655 | Unclassified | 4582 |
| 28 | Ga0466700_384307 | 3300042600 | Bacteria | 3339 |
| 29 | Ga0466717_156136 | 3300042604 | Bacteria | 1482 |
| 30 | IMNBL1DRAFT_c0000261 | 3300000062 | Bacteria | 46561 |
| 31 | IMNBL1DRAFT_c0000763 | 3300000062 | Bacteria | 25451 |
| 32 | JGI24699J35502_11134220 | 3300002509 | Bacteria | 66991 |
| 33 | Ga0123356_10004392 | 3300010049 | Bacteria | 14570 |
| 34 | Ga0123353_10637344 | 3300010167 | Bacteria | 1512 |
| 35 | Ga0466735_219120 | 3300042624 | Bacteria | 1555 |
| 36 | Ga0466702_197774 | 3300042635 | Bacteria | 2687 |
| 37 | Ga0466703_076115 | 3300042636 | Bacteria | 1907 |
| 38 | Ga0466703_266260 | 3300042636 | Unclassified | 1370 |
| 39 | Ga0466724_67704 | 3300042649 | Bacteria | 1606 |
| 40 | Ga0466714_101114 | 3300042603 | Bacteria | 64102 |
| 41 | Ga0466719_029385 | 3300042606 | Bacteria | 2062 |
| 42 | Ga0466720_001272 | 3300042607 | Bacteria | 2129 |
| 43 | Ga0466698_067044 | 3300042610 | Bacteria | 2090 |
| 44 | Ga0466698_130211 | 3300042610 | Bacteria | 1290 |
| 45 | Ga0466697_026926 | 3300042611 | Bacteria | 1421 |
| 46 | Ga0123357_10000378 | 3300009784 | Bacteria | 42074 |
| 47 | Ga0466715_082756 | 3300042616 | Bacteria | 2756 |
| 48 | Ga0466729_292570 | 3300042621 | Bacteria | 4189 |
| 49 | Ga0466731_196469 | 3300042622 | Bacteria | 1546 |
| 50 | Ga0466716_112131 | 3300042605 | Bacteria | 4207 |
| 51 | Ga0466719_019138 | 3300042606 | Bacteria | 17343 |
| 52 | Ga0466719_548928 | 3300042606 | Bacteria | 2383 |
| 53 | IMNBL1DRAFT_c0000308 | 3300000062 | Bacteria | 41637 |
| 54 | Ga0466705_095408 | 3300042612 | Bacteria | 2775 |
| 55 | Ga0466728_390398 | 3300042620 | Bacteria | 71913 |
| 56 | Ga0466729_004595 | 3300042621 | Bacteria | 5096 |
| 57 | Ga0123357_10193105 | 3300009784 | Bacteria | 2340 |
| 58 | Ga0123353_10137771 | 3300010167 | Bacteria | 3913 |
| 59 | Ga0123353_10244936 | 3300010167 | Bacteria | 2782 |
| 60 | Ga0466707_041041 | 3300042601 | Bacteria | 1925 |
| 61 | Ga0466713_054801 | 3300042602 | Bacteria | 20160 |
| 62 | JGI24695J34938_10050277 | 3300002450 | Bacteria | 1829 |
| 63 | Ga0466657_318711 | 3300042582 | Bacteria | 1264 |
| 64 | Ga0466692_164222 | 3300042591 | Bacteria | 15676 |
| 65 | Ga0466699_071408 | 3300042597 | Bacteria | 37193 |
| 66 | Ga0466733_138126 | 3300042659 | Bacteria | 81124 |
| 67 | Ga0123355_10000009 | 3300009826 | Bacteria | 191038 |
| 68 | Ga0123353_10046248 | 3300010167 | Bacteria | 6913 |
| 69 | Ga0123354_10041544 | 3300010882 | Bacteria | 7106 |
| 70 | Ga0466709_236051 | 3300042648 | Archaea | 1829 |
| 71 | Ga0466724_53629 | 3300042649 | Bacteria | 1216 |
| 72 | Ga0466708_433360 | 3300042652 | Bacteria | 6179 |
| 73 | Ga0466727_107843 | 3300042655 | Bacteria | 1831 |
| 74 | Ga0466707_047072 | 3300042601 | Bacteria | 1711 |
| 75 | Ga0466717_125151 | 3300042604 | Bacteria | 1983 |
| 76 | Ga0466721_086947 | 3300042608 | Bacteria | 22043 |
| 77 | Ga0456237_0014151 | 3300041968 | Bacteria | 1137 |
| 78 | Ga0466691_123325 | 3300042593 | Bacteria | 67193 |
| 79 | Ga0466733_138474 | 3300042659 | Bacteria | 6764 |
| 80 | Ga0466711_043879 | 3300042615 | Bacteria | 5259 |
| 81 | Ga0123356_10013604 | 3300010049 | Bacteria | 7843 |
| 82 | Ga0123356_10477510 | 3300010049 | Bacteria | 1399 |
| 83 | Ga0466703_168722 | 3300042636 | Bacteria | 14641 |
| 84 | Ga0466703_361404 | 3300042636 | Bacteria | 6607 |
| 85 | Ga0466701_077111 | 3300042598 | Bacteria | 3226 |
| 86 | Ga0466707_192365 | 3300042601 | Bacteria | 16028 |
| 87 | Ga0466714_133998 | 3300042603 | Bacteria | 6574 |
| 88 | JGI24696J40584_12939047 | 3300002834 | Bacteria | 1642 |
| 89 | Ga0466690_407297 | 3300042590 | Bacteria | 7851 |
| 90 | Ga0466691_219238 | 3300042593 | Bacteria | 11107 |
| 91 | Ga0466695_191402 | 3300042595 | Bacteria | 1230 |
| 92 | Ga0466705_016730 | 3300042612 | Bacteria | 4659 |
| 93 | Ga0466710_388025 | 3300042613 | Bacteria | 2891 |
| 94 | Ga0466726_285085 | 3300042619 | Bacteria | 21254 |
| 95 | Ga0123356_10001816 | 3300010049 | Bacteria | 23215 |
| 96 | Ga0123353_10000813 | 3300010167 | Bacteria | 38028 |
| 97 | Ga0466731_041143 | 3300042622 | Bacteria | 3174 |
| 98 | Ga0466704_562832 | 3300042643 | Unclassified | 2084 |
| 99 | Ga0466707_236570 | 3300042601 | Bacteria | 25314 |
| 100 | Ga0466713_083732 | 3300042602 | Bacteria | 22300 |
| 101 | Ga0466719_293836 | 3300042606 | Bacteria | 1962 |
| 102 | Ga0466720_063741 | 3300042607 | Bacteria | 20121 |
| 103 | Ga0466698_135527 | 3300042610 | Bacteria | 1833 |
| 104 | JGI24702J35022_10089138 | 3300002462 | Bacteria | 1677 |
| 105 | JGI24702J35022_10127150 | 3300002462 | Bacteria | 1412 |
| 106 | Ga0264413_129639 | 3300024493 | Bacteria | 4043 |
| 107 | Ga0466693_422703 | 3300042592 | Bacteria | 1782 |
| 108 | Ga0466699_325786 | 3300042597 | Bacteria | 1982 |
| 109 | Ga0466699_425188 | 3300042597 | Bacteria | 97421 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13310 | Virulence_RhuM | Virulence protein RhuM family | 117 | 367 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.