Protein Family IF04783
Metagenome
Isolate
148
Members
58
Samples
139
Scaffolds
413.74
Avg Length
Representative Sequence
- ID
- 3300042592|Ga0466693_206267|Ga0466693_206267_384_1688
- Length
- 434 aa
- Sequence
- MLKKCKVKRSKSVKRLDMEYIKRLTDNELERKVNSSGAVLVRGAKACGKTESAKQVAGSILKVDQDEQVSTMMELSPKRLLLGKTPRLIDEWQEYPKLWNYVRHEIDDRQQTAQFILTGSANPVESVKMHSGAGRFTTLDMRTMSWQELGFSSGKVSMNSLFEGAKIDIFDETTKLEFIVEKIITGGFPALIGKSKNQAVDLNRAYIDLLAEVDMSRVSNVKRDPVKVKNLLRSIARNTANIVDIATLATDIREKENSDISRPTIYEYMDALNRLMIIEEQPAWNPHIRSSASLRKSSKIHFTDVSLSVAALGIDAKSLFNNLPLTGFLFESMVTHDLRVYAQANDAKVYYYRDSSRLEVDAIVQKRNGDWIAFEIKLGTAQIEEAAANLKKFVSILDPQKVKLPQSLNIITGTGMSYTRADGINVISFASLGA
Sample Types
Isolate
6.1%
Metagenome
93.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.6%
Unclassified
19.6%
Kalotermitidae
19.6%
Rhinotermitidae
5.4%
Termopsidae
5.4%
Passalidae
3.6%
Hodotermitidae
1.8%
Taxonomy
Archaea
6
Bacteria
130
Eukaryota
0
Viruses
1
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 2 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 5 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 6 | 2820719201 | Unclassified Fibrobacteres Lab288P3bin119 | Isolate | Unclassified |
| 7 | 2684622742 | Methanobrevibacter curvatus DSM11111 | Isolate | Unclassified |
| 8 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 9 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 10 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 11 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 12 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 13 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 14 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 15 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 16 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 17 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 18 | 2820735654 | Unclassified Bacteroidetes Th196P4bin9 | Isolate | Unclassified |
| 19 | 2820765201 | Unclassified Bacteroidetes Lab288P3bin82 | Isolate | Unclassified |
| 20 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 21 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 22 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 23 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 24 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 25 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 26 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 27 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 28 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 29 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 30 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 31 | 2773857693 | Methanobrevibacter sp. Th196P3bin91 | Isolate | Unclassified |
| 32 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 33 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 34 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 35 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 36 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 37 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 38 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 39 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 40 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 41 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 42 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 43 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 44 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 45 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 46 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 47 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 48 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 49 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 50 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 51 | 2820767225 | Unclassified Bacteroidetes Lab288P3bin34 | Isolate | Unclassified |
| 52 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 53 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 54 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 55 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 56 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 57 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 58 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466690_134365 | 3300042590 | Bacteria | 3779 |
| 2 | Ga0466692_157497 | 3300042591 | Bacteria | 4127 |
| 3 | Ga0466693_206267 | 3300042592 | Bacteria | 2154 |
| 4 | Ga0466733_040060 | 3300042659 | Unclassified | 12215 |
| 5 | Ga0068302_10093387 | 3300005071 | Bacteria | 2705 |
| 6 | Ga0466715_379258 | 3300042616 | Bacteria | 7972 |
| 7 | Ga0123357_10314077 | 3300009784 | Archaea | 1560 |
| 8 | Ga0123353_10439679 | 3300010167 | Bacteria | 1925 |
| 9 | Ga0123354_10143780 | 3300010882 | Bacteria | 2933 |
| 10 | Ga0123354_10236816 | 3300010882 | Bacteria | 1890 |
| 11 | Ga0466722_123031 | 3300042609 | Bacteria | 32122 |
| 12 | Ga0466693_022521 | 3300042592 | Bacteria | 1626 |
| 13 | Ga0466697_199885 | 3300042611 | Archaea | 5176 |
| 14 | Ga0466705_313720 | 3300042612 | Bacteria | 20707 |
| 15 | Ga0466705_365617 | 3300042612 | Bacteria | 5503 |
| 16 | 2227175252 | 2225789004 | Bacteria | 8140 |
| 17 | 2227300233 | 2225789004 | Bacteria | 6611 |
| 18 | IMNBL1DRAFT_c0012080 | 3300000062 | Bacteria | 3976 |
| 19 | JGI24702J35022_10003795 | 3300002462 | Bacteria | 9076 |
| 20 | JGI24702J35022_10010224 | 3300002462 | Bacteria | 5253 |
| 21 | JGI24702J35022_10047912 | 3300002462 | Bacteria | 2275 |
| 22 | Ga0466705_418159 | 3300042612 | Bacteria | 1732 |
| 23 | Ga0466712_003192 | 3300042614 | Bacteria | 3920 |
| 24 | Ga0466711_038772 | 3300042615 | Bacteria | 2159 |
| 25 | Ga0466711_348105 | 3300042615 | Bacteria | 31872 |
| 26 | Ga0466709_239776 | 3300042648 | Bacteria | 4855 |
| 27 | Ga0123356_10001880 | 3300010049 | Bacteria | 22763 |
| 28 | Ga0123354_10114687 | 3300010882 | Bacteria | 3528 |
| 29 | Ga0466707_227267 | 3300042601 | Bacteria | 2899 |
| 30 | Ga0466713_145871 | 3300042602 | Bacteria | 6543 |
| 31 | Ga0466698_465325 | 3300042610 | Bacteria | 2591 |
| 32 | Ga0264413_156213 | 3300024493 | Unclassified | 1256 |
| 33 | Ga0466693_311529 | 3300042592 | Archaea | 1526 |
| 34 | Ga0466693_378272 | 3300042592 | Bacteria | 1503 |
| 35 | Ga0466696_399378 | 3300042596 | Bacteria | 3876 |
| 36 | Ga0466697_074228 | 3300042611 | Bacteria | 2605 |
| 37 | Ga0466733_197983 | 3300042659 | Unclassified | 1672 |
| 38 | JGI24702J35022_10000285 | 3300002462 | Bacteria | 29611 |
| 39 | Ga0072941_1007931 | 3300005201 | Bacteria | 36883 |
| 40 | Ga0072941_1206951 | 3300005201 | Bacteria | 1734 |
| 41 | Ga0466715_199024 | 3300042616 | Bacteria | 1882 |
| 42 | Ga0466728_023392 | 3300042620 | Bacteria | 6171 |
| 43 | Ga0466703_037426 | 3300042636 | Bacteria | 4903 |
| 44 | Ga0466704_224670 | 3300042643 | Unclassified | 6383 |
| 45 | Ga0466704_233062 | 3300042643 | Bacteria | 8217 |
| 46 | Ga0123356_10278579 | 3300010049 | Bacteria | 1766 |
| 47 | Ga0123353_10007351 | 3300010167 | Bacteria | 14863 |
| 48 | Ga0123353_10014473 | 3300010167 | Bacteria | 11377 |
| 49 | Ga0123354_10056341 | 3300010882 | Bacteria | 5869 |
| 50 | Ga0123354_10120006 | 3300010882 | Bacteria | 3402 |
| 51 | Ga0466707_032774 | 3300042601 | Bacteria | 8445 |
| 52 | Ga0466722_080395 | 3300042609 | Bacteria | 2657 |
| 53 | Ga0466698_167739 | 3300042610 | Bacteria | 1707 |
| 54 | Ga0466694_071352 | 3300042594 | Bacteria | 1798 |
| 55 | Ga0466694_075344 | 3300042594 | Bacteria | 2890 |
| 56 | Ga0466696_431058 | 3300042596 | Bacteria | 1987 |
| 57 | Ga0466705_058135 | 3300042612 | Bacteria | 5638 |
| 58 | Ga0466705_149104 | 3300042612 | Bacteria | 2599 |
| 59 | Ga0466732_017838 | 3300042656 | Bacteria | 18220 |
| 60 | IMNBL1DRAFT_c0006335 | 3300000062 | Bacteria | 6486 |
| 61 | AustNasuHG_c1000173 | 3300000089 | Bacteria | 20878 |
| 62 | JGI24702J35022_10002337 | 3300002462 | Bacteria | 11593 |
| 63 | Ga0068305_10228728 | 3300005083 | Bacteria | 1418 |
| 64 | Ga0466710_427335 | 3300042613 | Bacteria | 1733 |
| 65 | Ga0466712_143288 | 3300042614 | Bacteria | 2602 |
| 66 | Ga0466726_359877 | 3300042619 | Bacteria | 4032 |
| 67 | Ga0466731_016710 | 3300042622 | Bacteria | 3442 |
| 68 | Ga0466727_176744 | 3300042655 | Bacteria | 4766 |
| 69 | Ga0123357_10153271 | 3300009784 | Bacteria | 2788 |
| 70 | Ga0123357_10227395 | 3300009784 | Bacteria | 2054 |
| 71 | Ga0123353_10081350 | 3300010167 | Bacteria | 5208 |
| 72 | Ga0123354_10000498 | 3300010882 | Bacteria | 39457 |
| 73 | Ga0123354_10158948 | 3300010882 | Unclassified | 2694 |
| 74 | Ga0466707_345434 | 3300042601 | Bacteria | 28806 |
| 75 | Ga0466714_088054 | 3300042603 | Bacteria | 1558 |
| 76 | Ga0466714_161869 | 3300042603 | Bacteria | 1524 |
| 77 | Ga0466719_029948 | 3300042606 | Bacteria | 4303 |
| 78 | Ga0466719_448902 | 3300042606 | Bacteria | 1996 |
| 79 | Ga0264413_160880 | 3300024493 | Unclassified | 1383 |
| 80 | Ga0466690_160604 | 3300042590 | Bacteria | 4774 |
| 81 | Ga0466693_115105 | 3300042592 | Bacteria | 1633 |
| 82 | 2227474637 | 2225789004 | Bacteria | 22737 |
| 83 | JGI24695J34938_10060399 | 3300002450 | Bacteria | 1618 |
| 84 | JGI24702J35022_10046550 | 3300002462 | Bacteria | 2310 |
| 85 | JGI24705J35276_12235011 | 3300002504 | Bacteria | 6076 |
| 86 | Ga0068305_10035221 | 3300005083 | Unclassified | 2716 |
| 87 | Ga0466711_126492 | 3300042615 | Unclassified | 7082 |
| 88 | Ga0466715_410456 | 3300042616 | Bacteria | 8403 |
| 89 | Ga0466729_211515 | 3300042621 | Bacteria | 3912 |
| 90 | Ga0466731_127142 | 3300042622 | Bacteria | 1694 |
| 91 | Ga0466703_196407 | 3300042636 | Bacteria | 1649 |
| 92 | Ga0123356_10057548 | 3300010049 | Bacteria | 3624 |
| 93 | Ga0123353_10413871 | 3300010167 | Bacteria | 2000 |
| 94 | Ga0123353_10641989 | 3300010167 | Bacteria | 1505 |
| 95 | Ga0466706_013300 | 3300042599 | Archaea | 7943 |
| 96 | Ga0466707_198760 | 3300042601 | Bacteria | 3186 |
| 97 | Ga0466714_058710 | 3300042603 | Bacteria | 109931 |
| 98 | Ga0466721_080432 | 3300042608 | Bacteria | 1645 |
| 99 | Ga0466721_349002 | 3300042608 | Bacteria | 1753 |
| 100 | Ga0466690_083978 | 3300042590 | Bacteria | 4395 |
| 101 | Ga0466697_104875 | 3300042611 | Bacteria | 1734 |
| 102 | Ga0068302_10033108 | 3300005071 | Bacteria | 10829 |
| 103 | Ga0466718_032061 | 3300042617 | Unclassified | 13031 |
| 104 | Ga0466726_048500 | 3300042619 | Bacteria | 17749 |
| 105 | Ga0466731_016352 | 3300042622 | Bacteria | 1766 |
| 106 | Ga0466734_157707 | 3300042623 | Bacteria | 1589 |
| 107 | Ga0466703_158285 | 3300042636 | Bacteria | 84792 |
| 108 | Ga0466703_185589 | 3300042636 | Bacteria | 16758 |
| 109 | Ga0123357_10046187 | 3300009784 | Unclassified | 5908 |
| 110 | Ga0123356_10421695 | 3300010049 | Bacteria | 1477 |
| 111 | Ga0466713_126739 | 3300042602 | Bacteria | 2891 |
| 112 | Ga0466722_039281 | 3300042609 | Bacteria | 1854 |
| 113 | Ga0466657_314321 | 3300042582 | Bacteria | 1736 |
| 114 | Ga0466693_178903 | 3300042592 | Bacteria | 3681 |
| 115 | Ga0466705_008587 | 3300042612 | Bacteria | 6762 |
| 116 | JGI24702J35022_10040447 | 3300002462 | Bacteria | 2486 |
| 117 | Ga0466729_046364 | 3300042621 | Bacteria | 2414 |
| 118 | Ga0466725_427742 | 3300042654 | Bacteria | 6844 |
| 119 | Ga0123356_10030682 | 3300010049 | Bacteria | 5031 |
| 120 | Ga0123353_10000023 | 3300010167 | Bacteria | 173512 |
| 121 | Ga0123353_10225647 | 3300010167 | Bacteria | 2925 |
| 122 | Ga0123353_10446210 | 3300010167 | Bacteria | 1907 |
| 123 | Ga0466706_081618 | 3300042599 | Unclassified | 1422 |
| 124 | Ga0466707_155045 | 3300042601 | Bacteria | 5083 |
| 125 | Ga0466719_022099 | 3300042606 | Bacteria | 7722 |
| 126 | Ga0466719_512201 | 3300042606 | Bacteria | 4300 |
| 127 | Ga0466694_169164 | 3300042594 | Bacteria | 1824 |
| 128 | Ga0466705_096788 | 3300042612 | Bacteria | 4916 |
| 129 | Ga0466726_087159 | 3300042619 | Bacteria | 3726 |
| 130 | Ga0123355_10049676 | 3300009826 | Bacteria | 6818 |
| 131 | Ga0123356_10029200 | 3300010049 | Bacteria | 5167 |
| 132 | Ga0123356_10108697 | 3300010049 | Viruses | 2675 |
| 133 | Ga0123353_10018001 | 3300010167 | Bacteria | 10422 |
| 134 | Ga0123353_10198346 | 3300010167 | Bacteria | 3161 |
| 135 | Ga0123354_10097175 | 3300010882 | Bacteria | 4016 |
| 136 | Ga0466713_052034 | 3300042602 | Bacteria | 14972 |
| 137 | Ga0466716_130656 | 3300042605 | Bacteria | 2204 |
| 138 | Ga0466719_165133 | 3300042606 | Bacteria | 3034 |
| 139 | Ga0466720_003619 | 3300042607 | Bacteria | 6109 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.