Protein Family IF04668

Metagenome Isolate
169 Members
65 Samples
148 Scaffolds
282.42 Avg Length

🧬 Representative Sequence

ID
3300042591|Ga0466692_104985|Ga0466692_104985_4217_5143
Length
308 aa
Sequence
MKKNNTKNTNAATGTRAGGQGRSNALAASPDFTVFKGSADYVAGSELAMAVNVSIALEKPLLIKGEPGTGKTMLARSVADALGKKLVIWNIKSTTKAQDGLYVYDTVQRLYDSQFGEGDVKDIAKYIKYGKLGEAFTASEQVVLLIDEIDKADLEFPNDLLWELDQMEFYIPETKETVKAARRPIVIITSNAEKELPDAFLRRCVFHYIEFPDEEKMAEIVKVHYPDIEMNAVEQAMAKFYEIRAMKDIQKSPSTSELLDWLRALALSGVDLAAAEGELPFMGVLLKKNQDVDALAEYRVKGYTTVGW

📊 Sample Types

Isolate 12.4%
Metagenome 87.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 31.7%
Termitidae 25.4%
Kalotermitidae 22.2%
Termopsidae 6.3%
Passalidae 4.8%
Rhinotermitidae 3.2%
Coreidae 1.6%
Blattidae 1.6%
Culicidae 1.6%
Hodotermitidae 1.6%

🌳 Taxonomy

Archaea 0
Bacteria 158
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
2 8102094248 Caballeronia sp. GaOx3 Isolate Coreidae
3 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
4 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
5 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
6 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
7 2940228231 Anaerovoracaceae bacterium PM5-7 Isolate Blattidae
8 2820371985 Unclassified Firmicutes Nt197P3bin100 Isolate Unclassified
9 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
10 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
11 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
12 2711768164 Tritonibacter mobilis S1942 Isolate Unclassified
13 2781125639 Treponema sp. Co191P1bin44 Isolate Unclassified
14 2816332545 Tritonibacter mobilis S1923 Isolate Unclassified
15 2820238527 Unclassified Firmicutes Th196P3bin90 Isolate Unclassified
16 2820507989 Unclassified Firmicutes Lab288P1bin41 Isolate Unclassified
17 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
18 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
19 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
20 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
21 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
22 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
23 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
24 2718218026 Phaeobacter porticola P97 Isolate Unclassified
25 2820347164 Unclassified Firmicutes Nt197P3bin58 Isolate Unclassified
26 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
27 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
28 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
29 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
30 2820324456 Unclassified Firmicutes Nt197P3bin80 Isolate Unclassified
31 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
32 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
33 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
34 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
35 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
36 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
37 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
38 2806310572 Pukyongiella litopenaei SH-1 Isolate Unclassified
39 2820227065 Unclassified Firmicutes Th196P4bin44 Isolate Unclassified
40 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
41 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
42 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
43 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
44 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
45 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
46 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
47 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
48 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
49 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
50 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
51 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
52 2619619079 Sphingomonas sp. Mn802worker Isolate Termitidae
53 2820277137 Unclassified Firmicutes Th196P3bin150 Isolate Unclassified
54 2820314258 Unclassified Firmicutes Nt197P4bin16 Isolate Unclassified
55 2820340373 Unclassified Firmicutes Nt197P3bin67 Isolate Unclassified
56 2820357977 Unclassified Firmicutes Nt197P3bin136 Isolate Unclassified
57 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
58 2816332503 Tritonibacter mobilis S1611 Isolate Unclassified
59 2820106212 Unclassified Proteobacteria Emb289P4bin44 Isolate Unclassified
60 2820593525 Unclassified Firmicutes Emb289P1bin7 Isolate Unclassified
61 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
62 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
63 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
64 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
65 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_093856 3300042659 Bacteria 2520
2 IMNBL1DRAFT_c0000598 3300000062 Bacteria 28960
3 IMNBL1DRAFT_c0012857 3300000062 Bacteria 3797
4 JGI24702J35022_10130222 3300002462 Bacteria 1396
5 Ga0068302_10005093 3300005071 Bacteria 12657
6 Ga0072941_1322051 3300005201 Bacteria 1320
7 Ga0466706_209264 3300042599 Bacteria 11593
8 Ga0466716_410636 3300042605 Bacteria 4244
9 Ga0466656_056636 3300042550 Bacteria 5939
10 Ga0466693_153824 3300042592 Bacteria 3733
11 Ga0466693_200383 3300042592 Bacteria 5806
12 Ga0123355_10202885 3300009826 Bacteria 2892
13 Ga0160464_100193 3300012805 Bacteria 62115
14 Ga0466711_402895 3300042615 Bacteria 6319
15 Ga0466715_021720 3300042616 Bacteria 3047
16 Ga0466715_220531 3300042616 Unclassified 1483
17 Ga0466726_494294 3300042619 Bacteria 14793
18 Ga0466728_230690 3300042620 Bacteria 2703
19 Ga0466725_254026 3300042654 Bacteria 2580
20 Ga0123357_10000463 3300009784 Bacteria 39452
21 Ga0466713_021657 3300042602 Bacteria 46004
22 Ga0466719_118666 3300042606 Bacteria 1357
23 Ga0466719_481905 3300042606 Bacteria 4588
24 Ga0123356_10280110 3300010049 Bacteria 1762
25 Ga0123354_10115361 3300010882 Bacteria 3511
26 Ga0466703_146471 3300042636 Bacteria 1036
27 Ga0466703_209611 3300042636 Bacteria 6351
28 Ga0466704_115834 3300042643 Bacteria 49579
29 Ga0466704_230713 3300042643 Bacteria 4164
30 JGI24705J35276_12238294 3300002504 Bacteria 18750
31 Ga0466706_115064 3300042599 Bacteria 5164
32 Ga0160460_100080 3300012845 Bacteria 143504
33 Ga0415639_092521 3300038395 Bacteria 3417
34 Ga0466693_139044 3300042592 Bacteria 5545
35 Ga0466691_024230 3300042593 Bacteria 20082
36 Ga0466696_094475 3300042596 Unclassified 7857
37 Ga0123356_10513501 3300010049 Bacteria 1356
38 Ga0123353_10129967 3300010167 Bacteria 4043
39 Ga0466705_504814 3300042612 Bacteria 1489
40 Ga0466715_040719 3300042616 Bacteria 3570
41 Ga0466726_092349 3300042619 Bacteria 6543
42 Ga0466728_054424 3300042620 Bacteria 12755
43 Ga0466728_056674 3300042620 Bacteria 2231
44 Ga0466735_107598 3300042624 Bacteria 6940
45 Ga0466703_234815 3300042636 Bacteria 52704
46 Ga0466703_334577 3300042636 Bacteria 15759
47 Ga0466704_488488 3300042643 Bacteria 1544
48 Ga0466708_018535 3300042652 Bacteria 20076
49 Ga0466708_276037 3300042652 Bacteria 8527
50 Ga0466727_186553 3300042655 Bacteria 1665
51 Ga0466727_268828 3300042655 Bacteria 4301
52 Ga0466705_086928 3300042612 Bacteria 16352
53 Ga0466705_313696 3300042612 Bacteria 3075
54 IMNBL1DRAFT_c0000024 3300000062 Bacteria 141336
55 Ga0466706_141611 3300042599 Unclassified 1690
56 Ga0466707_080391 3300042601 Unclassified 3231
57 Ga0466707_125720 3300042601 Bacteria 31119
58 Ga0466707_332820 3300042601 Bacteria 2277
59 Ga0466719_338267 3300042606 Bacteria 2582
60 Ga0466722_187696 3300042609 Bacteria 1312
61 Ga0466690_261758 3300042590 Bacteria 1292
62 Ga0466691_115605 3300042593 Bacteria 28202
63 Ga0466691_146546 3300042593 Bacteria 8188
64 Ga0466691_186620 3300042593 Bacteria 3961
65 Ga0466691_193017 3300042593 Unclassified 4014
66 Ga0466696_052765 3300042596 Bacteria 20018
67 Ga0123355_10326049 3300009826 Bacteria 2063
68 Ga0123356_10040614 3300010049 Bacteria 4334
69 Ga0123353_10210409 3300010167 Bacteria 3051
70 Ga0123354_10065467 3300010882 Bacteria 5317
71 Ga0466705_390019 3300042612 Unclassified 2077
72 Ga0466711_094978 3300042615 Bacteria 1257
73 Ga0466723_183526 3300042618 Bacteria 2764
74 Ga0466723_346755 3300042618 Bacteria 6962
75 Ga0466726_181648 3300042619 Bacteria 2967
76 Ga0466703_030708 3300042636 Bacteria 19563
77 Ga0466704_097371 3300042643 Bacteria 4191
78 Ga0466727_157605 3300042655 Bacteria 4214
79 Ga0466727_173039 3300042655 Bacteria 2603
80 Ga0466705_145284 3300042612 Bacteria 5199
81 2227574620 2225789004 Bacteria 13737
82 Ga0068302_10143085 3300005071 Bacteria 2644
83 Ga0466706_119686 3300042599 Unclassified 1036
84 Ga0466707_027489 3300042601 Bacteria 13524
85 Ga0466707_055027 3300042601 Bacteria 3571
86 Ga0466713_033410 3300042602 Bacteria 35675
87 Ga0466713_121178 3300042602 Bacteria 22443
88 Ga0415639_235031 3300038395 Bacteria 3620
89 Ga0466692_065539 3300042591 Bacteria 30371
90 Ga0466691_010193 3300042593 Bacteria 1902
91 Ga0123357_10055292 3300009784 Bacteria 5344
92 Ga0123356_10032062 3300010049 Bacteria 4918
93 Ga0123356_10186359 3300010049 Bacteria 2102
94 Ga0123353_10273399 3300010167 Bacteria 2601
95 Ga0466711_179965 3300042615 Bacteria 6116
96 Ga0466715_315064 3300042616 Bacteria 3295
97 Ga0466723_194967 3300042618 Bacteria 3185
98 Ga0466704_455161 3300042643 Bacteria 2490
99 Ga0466705_215913 3300042612 Bacteria 12843
100 2227075219 2225789003 Unclassified 11540
101 JGI24695J34938_10030830 3300002450 Unclassified 2493
102 Ga0466707_266272 3300042601 Bacteria 12528
103 Ga0466707_345577 3300042601 Bacteria 2168
104 Ga0466692_104985 3300042591 Bacteria 5572
105 Ga0466696_389889 3300042596 Bacteria 7146
106 Ga0123353_10105236 3300010167 Bacteria 4547
107 Ga0123353_10773118 3300010167 Bacteria 1332
108 Ga0466715_266326 3300042616 Bacteria 5223
109 Ga0466715_644449 3300042616 Bacteria 3647
110 Ga0466728_039352 3300042620 Bacteria 2259
111 Ga0466728_305211 3300042620 Bacteria 3940
112 Ga0466734_053954 3300042623 Bacteria 16315
113 Ga0466704_126627 3300042643 Bacteria 43828
114 Ga0466705_028923 3300042612 Bacteria 1827
115 Ga0466733_062308 3300042659 Bacteria 1471
116 Ga0466700_182142 3300042600 Bacteria 2038
117 Ga0466707_404385 3300042601 Bacteria 5608
118 Ga0466713_031736 3300042602 Bacteria 24998
119 Ga0466716_523607 3300042605 Bacteria 1174
120 Ga0415639_104900 3300038395 Bacteria 1583
121 Ga0466696_193364 3300042596 Bacteria 3760
122 Ga0123353_10106027 3300010167 Bacteria 4529
123 Ga0123353_10118696 3300010167 Bacteria 4253
124 Ga0466705_509443 3300042612 Bacteria 1255
125 Ga0466715_622033 3300042616 Bacteria 5791
126 Ga0466726_204964 3300042619 Bacteria 6431
127 Ga0466726_306765 3300042619 Bacteria 7759
128 Ga0466728_180742 3300042620 Unclassified 1679
129 Ga0466704_097970 3300042643 Bacteria 6913
130 Ga0466705_015981 3300042612 Bacteria 29404
131 Ga0466705_094204 3300042612 Bacteria 3792
132 Ga0466733_107963 3300042659 Bacteria 1681
133 Ga0466706_022538 3300042599 Bacteria 1772
134 Ga0466707_254755 3300042601 Bacteria 7634
135 Ga0466713_089136 3300042602 Bacteria 1718
136 Ga0123355_10089501 3300009826 Bacteria 4885
137 Ga0123356_10018695 3300010049 Bacteria 6578
138 Ga0123353_10305543 3300010167 Bacteria 2425
139 Ga0123353_10656878 3300010167 Bacteria 1483
140 Ga0466705_521894 3300042612 Bacteria 138507
141 Ga0466711_096199 3300042615 Bacteria 8415
142 Ga0466723_165771 3300042618 Bacteria 2422
143 Ga0466723_360618 3300042618 Unclassified 5222
144 Ga0466728_043018 3300042620 Bacteria 6014
145 Ga0466728_091184 3300042620 Bacteria 1376
146 Ga0466728_122940 3300042620 Bacteria 1979
147 Ga0466703_054566 3300042636 Bacteria 1322
148 Ga0466709_374255 3300042648 Bacteria 116572

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF07728 AAA_5 AAA domain (dynein-related subfamily) 60 204 0.89
PF00004 AAA ATPase family associated with various cellular activities (AAA) 61 206 0.77
PF07724 AAA_2 AAA domain (Cdc48 subfamily) 62 199 0.76
PF13401 AAA_22 AAA domain 60 160 0.74

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF13401 GO:0016887 ATP hydrolysis activity MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.