Protein Family IF04641
Metagenome
Isolate
162
Members
119
Samples
106
Scaffolds
209.18
Avg Length
Representative Sequence
- ID
- 3300042591|Ga0466692_063852|Ga0466692_063852_18247_18939
- Length
- 230 aa
- Sequence
- MAVEKRESFVIDWQRKIMEKFTALTGLVAPLDRSNIDTDAIIPKQFLKSIKRSGFGVNAFDEWRYLDHGEPGMDNRSRPLNPNFVLNQERYRGASILLVRANFGCGSSREHAPWALVDYGFKVILAESFADIFFNNSFKNGLLPLVLPRAEIDALFALVEAAPGFSLAVDLAAQTLTRPDGYVISFPVDLFRKECLLNGWDDIGLTLRHTDEIRAFEERRRAEQPWLFPA
Sample Types
Isolate
34.6%
Metagenome
65.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
18.1%
Unclassified
16.4%
Coreidae
12.9%
Kalotermitidae
11.2%
Formicidae
10.3%
Elmidae
6.0%
Culicidae
5.2%
Aphididae
3.4%
Rhinotermitidae
3.4%
Largidae
1.7%
Blattidae
1.7%
Drosophilidae
1.7%
Passalidae
0.9%
Pseudococcidae
0.9%
Hodotermitidae
0.9%
Cerambycidae
0.9%
Curculionidae
0.9%
Berytidae
0.9%
Termopsidae
0.9%
Pediculidae
0.9%
Noctuidae
0.9%
Taxonomy
Archaea
0
Bacteria
158
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2508501067 | Opitutaceae bacterium TAV1 | Isolate | Unclassified |
| 2 | 2639763186 | Opitutaceae bacterium TAV4 | Isolate | Unclassified |
| 3 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 4 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 5 | 2864863795 | Acinetobacter johnsonii S00116 | Isolate | Elmidae |
| 6 | 2884492481 | Buchnera aphidicola BuCicurtihirsuta/3053 | Isolate | Aphididae |
| 7 | 2884492905 | Buchnera aphidicola BuCipiceae/3303 | Isolate | Aphididae |
| 8 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 9 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 10 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 11 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 12 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 13 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 14 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 15 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 16 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 17 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 18 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 19 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 20 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 21 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 22 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 23 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 24 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 25 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 26 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 27 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 28 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 29 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 30 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 31 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 32 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 33 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 34 | 8021899934 | Acinetobacter sp. AR2-3 | Isolate | Culicidae |
| 35 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 36 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 37 | 650716018 | Candidatus Tremblaya princeps PCIT | Isolate | Pseudococcidae |
| 38 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 39 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 40 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 41 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 42 | 2084038013 | Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae | Metagenome | Cerambycidae |
| 43 | 2820121232 | Unclassified Proteobacteria Emb289P4bin32 | Isolate | Unclassified |
| 44 | 2864804954 | Acinetobacter johnsonii S00050 | Isolate | Elmidae |
| 45 | 2864973726 | Acinetobacter schindleri S00243 | Isolate | Elmidae |
| 46 | 2884498641 | Buchnera aphidicola BuCicurvipes/3402 | Isolate | Aphididae |
| 47 | 2940377351 | Ereboglobus sp. PH5-5 | Isolate | Blattidae |
| 48 | 3006190525 | Acinetobacter sp. S54 | Isolate | Curculionidae |
| 49 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 50 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 51 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 52 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 53 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 54 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 55 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 56 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 57 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 58 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 59 | 2524614573 | Marinospirillum minutulum DSM 6287 | Isolate | Unclassified |
| 60 | 2619619079 | Sphingomonas sp. Mn802worker | Isolate | Termitidae |
| 61 | 2864874997 | Acinetobacter lwoffii S00127 | Isolate | Elmidae |
| 62 | 2841132873 | Buchnera aphidicola BTs Pazieg | Isolate | Aphididae |
| 63 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 64 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 65 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 66 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 67 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 68 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 69 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 70 | 2603880164 | Opitutus sp. | Isolate | Formicidae |
| 71 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 72 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 73 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 74 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 75 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 76 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 77 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 78 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 79 | 2639763185 | Opitutaceae bacterium TAV3 | Isolate | Unclassified |
| 80 | 2706794701 | Opitutaceae bacterium TSB47 | Isolate | Rhinotermitidae |
| 81 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 82 | 2864840607 | Acinetobacter johnsonii S00071 | Isolate | Elmidae |
| 83 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 84 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 85 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 86 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 87 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 88 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 89 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 90 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 91 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 92 | 2820042117 | Unclassified Proteobacteria Th196P4bin58 | Isolate | Unclassified |
| 93 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 94 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 95 | 2820132692 | Unclassified Proteobacteria Emb289P3bin76 | Isolate | Unclassified |
| 96 | 2857493320 | Opitutaceae bacterium TAV3 | Isolate | Unclassified |
| 97 | 2864843793 | Acinetobacter johnsonii S00075 | Isolate | Elmidae |
| 98 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 99 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 100 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 101 | 641522603 | Acinetobacter baumannii SDF | Isolate | Pediculidae |
| 102 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 103 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 104 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 105 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 106 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 107 | 2517572100 | Geminisphaera colitermitum TAV2 | Isolate | Unclassified |
| 108 | 2531839311 | Acinetobacter sp. HA | Isolate | Noctuidae |
| 109 | 2820062699 | Unclassified Proteobacteria Nt197P4bin15 | Isolate | Unclassified |
| 110 | 2820152154 | Unclassified Proteobacteria Cu122P5bin47 | Isolate | Unclassified |
| 111 | 2857498920 | Opitutaceae bacterium TAV4 | Isolate | Unclassified |
| 112 | 2940239174 | Ereboglobus sp. PH5-10 | Isolate | Blattidae |
| 113 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 114 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 115 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 116 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 117 | 3300009471 | Microbial communities of aphids from galls on Rhus javanica in Mt Takao, Hachioji, Japan - Schlechtendalia chinensis CVD94-71 seqcov | Metagenome | |
| 118 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 119 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0160470_107637 | 3300012813 | Unclassified | 1149 |
| 2 | Ga0466711_234910 | 3300042615 | Bacteria | 1463 |
| 3 | Ga0466715_316385 | 3300042616 | Bacteria | 19410 |
| 4 | Ga0123354_10000381 | 3300010882 | Bacteria | 42382 |
| 5 | Ga0123354_10506209 | 3300010882 | Bacteria | 938 |
| 6 | IMNBGM34_c004043 | 3300000036 | Bacteria | 2001 |
| 7 | JGI24702J35022_10024622 | 3300002462 | Bacteria | 3251 |
| 8 | JGI24705J35276_12235422 | 3300002504 | Bacteria | 6515 |
| 9 | Ga0466704_485277 | 3300042643 | Bacteria | 2853 |
| 10 | Ga0466657_135704 | 3300042582 | Bacteria | 8965 |
| 11 | Ga0466657_347002 | 3300042582 | Bacteria | 3899 |
| 12 | Ga0466692_063852 | 3300042591 | Bacteria | 48253 |
| 13 | Ga0466691_026404 | 3300042593 | Bacteria | 5995 |
| 14 | Ga0466710_038761 | 3300042613 | Bacteria | 64329 |
| 15 | Ga0466710_152128 | 3300042613 | Bacteria | 28408 |
| 16 | Ga0466723_002341 | 3300042618 | Bacteria | 3500 |
| 17 | Ga0466728_337367 | 3300042620 | Bacteria | 7312 |
| 18 | Ga0160454_100143 | 3300012798 | Bacteria | 86289 |
| 19 | JGI24702J35022_10024872 | 3300002462 | Bacteria | 3233 |
| 20 | Ga0102736_1000060 | 3300007052 | Bacteria | 100494 |
| 21 | Ga0466709_197804 | 3300042648 | Bacteria | 5881 |
| 22 | Ga0466724_26794 | 3300042649 | Bacteria | 2684 |
| 23 | Ga0466708_257858 | 3300042652 | Bacteria | 11355 |
| 24 | Ga0466727_203749 | 3300042655 | Bacteria | 45935 |
| 25 | Ga0160460_102977 | 3300012845 | Bacteria | 3293 |
| 26 | Ga0466690_292632 | 3300042590 | Bacteria | 16499 |
| 27 | Ga0466710_381390 | 3300042613 | Bacteria | 32855 |
| 28 | Ga0123353_10013509 | 3300010167 | Bacteria | 11702 |
| 29 | Ga0466706_116404 | 3300042599 | Bacteria | 2886 |
| 30 | Ga0466713_012784 | 3300042602 | Bacteria | 1400 |
| 31 | Ga0466713_034647 | 3300042602 | Bacteria | 26025 |
| 32 | JGI24702J35022_10000310 | 3300002462 | Bacteria | 28806 |
| 33 | Ga0072941_1318341 | 3300005201 | Bacteria | 3835 |
| 34 | Ga0102737_1000363 | 3300007142 | Bacteria | 15330 |
| 35 | Ga0127653_100120 | 3300009471 | Bacteria | 188812 |
| 36 | Ga0123357_10000285 | 3300009784 | Bacteria | 48399 |
| 37 | Ga0466725_037252 | 3300042654 | Bacteria | 45444 |
| 38 | Ga0466725_385790 | 3300042654 | Bacteria | 2867 |
| 39 | Ga0466690_117806 | 3300042590 | Bacteria | 8895 |
| 40 | Ga0466718_003567 | 3300042617 | Bacteria | 3336 |
| 41 | Ga0466723_204311 | 3300042618 | Bacteria | 16096 |
| 42 | Ga0466707_023685 | 3300042601 | Bacteria | 19427 |
| 43 | Ga0466716_548766 | 3300042605 | Bacteria | 4052 |
| 44 | Ga0466719_071789 | 3300042606 | Bacteria | 5803 |
| 45 | IMNBGM34_c000918 | 3300000036 | Bacteria | 6408 |
| 46 | JGI24695J34938_10232701 | 3300002450 | Bacteria | 777 |
| 47 | Ga0103266_1000038 | 3300007067 | Bacteria | 205800 |
| 48 | Ga0466734_040544 | 3300042623 | Bacteria | 2338 |
| 49 | Ga0466724_08031 | 3300042649 | Bacteria | 72239 |
| 50 | Ga0466708_175810 | 3300042652 | Bacteria | 81328 |
| 51 | Ga0466705_012404 | 3300042612 | Unclassified | 2074 |
| 52 | Ga0160446_100297 | 3300012835 | Bacteria | 29144 |
| 53 | Ga0466657_047577 | 3300042582 | Bacteria | 20534 |
| 54 | Ga0466691_077588 | 3300042593 | Bacteria | 24167 |
| 55 | Ga0466707_373362 | 3300042601 | Bacteria | 8557 |
| 56 | Ga0466713_140799 | 3300042602 | Bacteria | 19248 |
| 57 | Ga0466722_051357 | 3300042609 | Bacteria | 3271 |
| 58 | AglaG_contig01883 | 2084038013 | Bacteria | 1171 |
| 59 | Ga0103264_1000304 | 3300007188 | Bacteria | 27092 |
| 60 | Ga0105005_1037987 | 3300007505 | Bacteria | 6781 |
| 61 | Ga0466702_456782 | 3300042635 | Bacteria | 4086 |
| 62 | Ga0466705_087780 | 3300042612 | Bacteria | 84355 |
| 63 | Ga0466732_278187 | 3300042656 | Bacteria | 3568 |
| 64 | Ga0160458_105062 | 3300012832 | Bacteria | 1579 |
| 65 | Ga0160460_100348 | 3300012845 | Bacteria | 31946 |
| 66 | Ga0466657_142224 | 3300042582 | Bacteria | 5844 |
| 67 | Ga0466712_043328 | 3300042614 | Bacteria | 3883 |
| 68 | Ga0466711_275509 | 3300042615 | Bacteria | 1934 |
| 69 | Ga0123353_10032635 | 3300010167 | Bacteria | 8090 |
| 70 | Ga0123353_10121533 | 3300010167 | Bacteria | 4199 |
| 71 | Ga0466707_186237 | 3300042601 | Unclassified | 7567 |
| 72 | Ga0103261_1000023 | 3300007083 | Bacteria | 256806 |
| 73 | Ga0102739_1000028 | 3300007095 | Bacteria | 90454 |
| 74 | Ga0102734_1000743 | 3300007129 | Bacteria | 8841 |
| 75 | Ga0104019_1002043 | 3300007150 | Bacteria | 2941 |
| 76 | Ga0104019_1004714 | 3300007150 | Bacteria | 5990 |
| 77 | Ga0466734_092086 | 3300042623 | Bacteria | 5203 |
| 78 | Ga0466692_024378 | 3300042591 | Bacteria | 43078 |
| 79 | Ga0466692_077892 | 3300042591 | Bacteria | 7673 |
| 80 | Ga0466729_155179 | 3300042621 | Bacteria | 91460 |
| 81 | Ga0123355_10955712 | 3300009826 | Bacteria | 919 |
| 82 | Ga0123356_10020901 | 3300010049 | Bacteria | 6191 |
| 83 | Ga0123356_10170998 | 3300010049 | Bacteria | 2183 |
| 84 | Ga0123354_10234811 | 3300010882 | Bacteria | 1906 |
| 85 | Ga0466719_393880 | 3300042606 | Bacteria | 2137 |
| 86 | Ga0466698_359320 | 3300042610 | Bacteria | 1127 |
| 87 | CVPL005L_10000102 | 3300002938 | Bacteria | 62025 |
| 88 | Ga0466730_102983 | 3300042625 | Unclassified | 1035 |
| 89 | Ga0466703_021322 | 3300042636 | Bacteria | 7887 |
| 90 | Ga0466703_412632 | 3300042636 | Bacteria | 4408 |
| 91 | Ga0466704_258426 | 3300042643 | Bacteria | 95131 |
| 92 | Ga0466733_129929 | 3300042659 | Bacteria | 2136 |
| 93 | Ga0160459_100150 | 3300012831 | Bacteria | 40128 |
| 94 | Ga0466657_034180 | 3300042582 | Bacteria | 1271 |
| 95 | Ga0466657_390823 | 3300042582 | Bacteria | 58911 |
| 96 | Ga0466690_134399 | 3300042590 | Bacteria | 25770 |
| 97 | Ga0123353_10799091 | 3300010167 | Bacteria | 1303 |
| 98 | CVPL010W_10000025 | 3300002931 | Bacteria | 82116 |
| 99 | Ga0102735_1000037 | 3300007080 | Bacteria | 61745 |
| 100 | Ga0102737_1000219 | 3300007142 | Bacteria | 19343 |
| 101 | Ga0103268_1000431 | 3300007192 | Bacteria | 24715 |
| 102 | Ga0466730_062864 | 3300042625 | Bacteria | 13200 |
| 103 | Ga0466724_35102 | 3300042649 | Bacteria | 4882 |
| 104 | Ga0466708_064045 | 3300042652 | Bacteria | 19560 |
| 105 | Ga0466708_355353 | 3300042652 | Bacteria | 40735 |
| 106 | Ga0466725_407998 | 3300042654 | Bacteria | 13599 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00694 | Aconitase_C | Aconitase C-terminal domain | 18 | 149 | 0.93 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.