Protein Family IF04624

Metagenome Isolate
145 Members
66 Samples
120 Scaffolds
203.92 Avg Length

🧬 Representative Sequence

ID
3300042591|Ga0466692_039380|Ga0466692_039380_3993_4583
Length
188 aa
Sequence
MTQVWSEDDRIIPVTVIQAGPCTVAQVKTAAKEGYEAIQIGYGDVKANKVNKPMAGHFEKNGVDPCRVLREVRVDDASAYEANQKITVEEFAEVKSVNVSGVSKGKGFAGVMKRHNFHGGPGSHGAVGQCATPSRVFKGLKLPGHMGDEKVTVRNLELVKIDVEQNLLLVKGAVPGGKGALLTVKSAS

📊 Sample Types

Isolate 17.2%
Metagenome 82.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 37.9%
Termitidae 31.8%
Kalotermitidae 15.2%
Rhinotermitidae 4.5%
Termopsidae 4.5%
Blattidae 1.5%
Pyrrhocoridae 1.5%
Passalidae 1.5%
Hodotermitidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 141
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820822094 Unclassified Actinobacteria Nt197P3bin131 Isolate Unclassified
2 2820942695 Unclassified Actinobacteria Cu122P5bin37 Isolate Unclassified
3 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
4 2820811576 Unclassified Actinobacteria Nt197P3bin53 Isolate Unclassified
5 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
6 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
7 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
8 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
9 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
10 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
11 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
12 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
13 2820848511 Unclassified Actinobacteria Lab288P3bin86 Isolate Unclassified
14 2820917597 Unclassified Actinobacteria Emb289P3bin57 Isolate Unclassified
15 2820941830 Unclassified Actinobacteria Cu122P5bin49 Isolate Unclassified
16 2940228231 Anaerovoracaceae bacterium PM5-7 Isolate Blattidae
17 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
18 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
19 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
20 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
21 2503538010 Coriobacterium glomerans PW2, DSM 20642 Isolate Pyrrhocoridae
22 2820856540 Unclassified Actinobacteria Lab288P3bin21 Isolate Unclassified
23 2820874551 Unclassified Actinobacteria Lab288P1bin85 Isolate Unclassified
24 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
25 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
26 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
27 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
28 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
29 2820800812 Unclassified Actinobacteria Th196P4bin28 Isolate Unclassified
30 2820880921 Unclassified Actinobacteria Lab288P1bin60 Isolate Unclassified
31 2820934415 Unclassified Actinobacteria Emb289P1bin68 Isolate Unclassified
32 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
33 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
34 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
35 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
36 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
37 2820833147 Unclassified Actinobacteria Lab288P4bin85 Isolate Unclassified
38 2820836992 Unclassified Actinobacteria Lab288P4bin32 Isolate Unclassified
39 2820906387 Unclassified Actinobacteria Emb289P4bin41 Isolate Unclassified
40 2821322763 Unclassified Actinobacteria Cu122P5bin19 Isolate Unclassified
41 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
42 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
43 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
44 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
45 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
46 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
47 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
48 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
49 2820813074 Unclassified Actinobacteria Nt197P3bin52 Isolate Unclassified
50 2820854745 Unclassified Actinobacteria Lab288P3bin234 Isolate Unclassified
51 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
52 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
53 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
54 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
55 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
56 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
57 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
58 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
59 2820799971 Unclassified Actinobacteria Th196P4bin46 Isolate Unclassified
60 2820823448 Unclassified Actinobacteria Nt197P3bin113 Isolate Unclassified
61 2820831444 Unclassified Actinobacteria Nc150P4bin21 Isolate Unclassified
62 2820916033 Unclassified Actinobacteria Emb289P3bin63 Isolate Unclassified
63 2820924633 Unclassified Actinobacteria Emb289P3bin142 Isolate Unclassified
64 2820939604 Unclassified Actinobacteria Emb289P1bin4 Isolate Unclassified
65 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
66 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_139183 3300042612 Bacteria 4539
2 JGI24695J34938_10041485 3300002450 Bacteria 2066
3 JGI24702J35022_10362533 3300002462 Bacteria 868
4 Ga0068302_10015651 3300005071 Bacteria 22613
5 Ga0072940_1070821 3300005200 Bacteria 9131
6 Ga0466692_203301 3300042591 Bacteria 6151
7 Ga0466696_417783 3300042596 Bacteria 3008
8 Ga0466707_033064 3300042601 Bacteria 5416
9 Ga0466719_092416 3300042606 Bacteria 67606
10 Ga0466719_274679 3300042606 Bacteria 3752
11 Ga0466726_380315 3300042619 Bacteria 17436
12 Ga0123357_10008408 3300009784 Bacteria 12887
13 Ga0123357_10093943 3300009784 Bacteria 3896
14 Ga0466703_275592 3300042636 Bacteria 11908
15 Ga0466704_271534 3300042643 Bacteria 4211
16 Ga0466727_230261 3300042655 Bacteria 2951
17 IMNBL1DRAFT_c0004990 3300000062 Bacteria 7745
18 Ga0466656_057846 3300042550 Bacteria 1263
19 Ga0466692_078337 3300042591 Bacteria 9721
20 Ga0466713_143789 3300042602 Bacteria 39342
21 Ga0466717_002338 3300042604 Bacteria 6314
22 Ga0466717_102305 3300042604 Bacteria 35520
23 Ga0466716_502232 3300042605 Bacteria 1061
24 Ga0466726_196699 3300042619 Unclassified 15690
25 Ga0123357_10393525 3300009784 Bacteria 1270
26 Ga0123356_10256365 3300010049 Bacteria 1830
27 Ga0123353_10321506 3300010167 Bacteria 2348
28 Ga0123353_10658935 3300010167 Bacteria 1480
29 Ga0466731_080692 3300042622 Bacteria 4240
30 Ga0466704_418829 3300042643 Bacteria 8884
31 Ga0466708_083377 3300042652 Bacteria 45280
32 Ga0466708_351496 3300042652 Bacteria 8696
33 Ga0466705_220327 3300042612 Bacteria 34237
34 JGI24705J35276_12108455 3300002504 Bacteria 1037
35 Ga0466690_157782 3300042590 Bacteria 2964
36 Ga0466701_073876 3300042598 Bacteria 1233
37 Ga0466706_196975 3300042599 Bacteria 1797
38 Ga0466707_052185 3300042601 Bacteria 4119
39 Ga0466722_085569 3300042609 Bacteria 5380
40 Ga0466726_376208 3300042619 Bacteria 25969
41 Ga0123357_10012257 3300009784 Bacteria 11047
42 Ga0123356_10667390 3300010049 Bacteria 1207
43 Ga0123353_10316257 3300010167 Bacteria 2372
44 Ga0123353_10466715 3300010167 Bacteria 1853
45 Ga0123353_11010631 3300010167 Bacteria 1116
46 Ga0466708_179558 3300042652 Bacteria 2887
47 Ga0466705_210922 3300042612 Bacteria 8379
48 Ga0466733_016289 3300042659 Bacteria 2742
49 JGI24705J35276_12142358 3300002504 Bacteria 1147
50 JGI24699J35502_11121230 3300002509 Bacteria 3319
51 Ga0466656_132837 3300042550 Bacteria 2253
52 Ga0466693_189648 3300042592 Bacteria 16531
53 Ga0466696_011597 3300042596 Bacteria 4540
54 Ga0466722_183422 3300042609 Bacteria 24688
55 Ga0466698_217530 3300042610 Bacteria 3040
56 Ga0123353_10000803 3300010167 Bacteria 38182
57 Ga0123354_10012403 3300010882 Bacteria 13208
58 Ga0466729_309738 3300042621 Bacteria 19337
59 Ga0466734_061713 3300042623 Bacteria 7989
60 Ga0466703_348284 3300042636 Bacteria 9095
61 Ga0466704_008359 3300042643 Bacteria 5557
62 Ga0466704_199178 3300042643 Bacteria 10818
63 Ga0466708_414335 3300042652 Bacteria 2887
64 Ga0068302_10025260 3300005071 Bacteria 19492
65 Ga0466692_039380 3300042591 Bacteria 8908
66 Ga0466692_188179 3300042591 Bacteria 34936
67 Ga0466693_070193 3300042592 Bacteria 6074
68 Ga0466706_072070 3300042599 Bacteria 8366
69 Ga0466706_208273 3300042599 Bacteria 1687
70 Ga0466707_227909 3300042601 Bacteria 1069
71 Ga0466713_104153 3300042602 Bacteria 73386
72 Ga0466717_084223 3300042604 Bacteria 1067
73 Ga0466705_507321 3300042612 Unclassified 4613
74 Ga0466715_301768 3300042616 Bacteria 11970
75 Ga0123355_10010726 3300009826 Bacteria 14078
76 Ga0123356_10000248 3300010049 Bacteria 61776
77 Ga0123356_10113912 3300010049 Bacteria 2617
78 Ga0123353_10406892 3300010167 Bacteria 2022
79 Ga0123353_11564795 3300010167 Bacteria 835
80 Ga0466703_165604 3300042636 Bacteria 2117
81 Ga0466697_125710 3300042611 Bacteria 8141
82 Ga0466707_098926 3300042601 Bacteria 16720
83 Ga0466715_007229 3300042616 Bacteria 1346
84 Ga0123357_10487458 3300009784 Bacteria 1036
85 Ga0123353_10237840 3300010167 Bacteria 2832
86 Ga0123353_11483132 3300010167 Bacteria 865
87 Ga0123354_10234349 3300010882 Bacteria 1909
88 Ga0466703_087274 3300042636 Bacteria 28228
89 Ga0466708_097335 3300042652 Bacteria 43487
90 JGI24702J35022_10000002 3300002462 Bacteria 104026
91 Ga0466656_266927 3300042550 Bacteria 1091
92 Ga0466692_113392 3300042591 Bacteria 42952
93 Ga0466692_120688 3300042591 Bacteria 1437
94 Ga0466693_023801 3300042592 Bacteria 5019
95 Ga0466717_189836 3300042604 Bacteria 4136
96 Ga0466728_043237 3300042620 Bacteria 51050
97 Ga0123355_10003978 3300009826 Bacteria 21391
98 Ga0123355_10986333 3300009826 Bacteria 897
99 Ga0123356_10045539 3300010049 Bacteria 4082
100 Ga0123353_11195456 3300010167 Bacteria 998
101 Ga0466705_279280 3300042612 Bacteria 14131
102 JGI24705J35276_12233212 3300002504 Bacteria 4716
103 Ga0466657_368604 3300042582 Bacteria 2066
104 Ga0466693_115454 3300042592 Bacteria 1657
105 Ga0466696_064151 3300042596 Bacteria 18163
106 Ga0466696_199260 3300042596 Unclassified 2401
107 Ga0466696_217003 3300042596 Bacteria 1464
108 Ga0466706_047187 3300042599 Bacteria 8000
109 Ga0466707_206212 3300042601 Bacteria 6443
110 Ga0466710_348449 3300042613 Bacteria 7553
111 Ga0466710_386009 3300042613 Bacteria 1346
112 Ga0466729_048668 3300042621 Bacteria 1569
113 Ga0123357_10050227 3300009784 Bacteria 5647
114 Ga0123356_10001853 3300010049 Bacteria 22938
115 Ga0123353_10015115 3300010167 Bacteria 11188
116 Ga0123353_10684032 3300010167 Bacteria 1444
117 Ga0123354_10250119 3300010882 Bacteria 1798
118 Ga0466703_119275 3300042636 Bacteria 5469
119 Ga0466704_435702 3300042643 Bacteria 9389
120 Ga0466727_268503 3300042655 Unclassified 1932

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00297 Ribosomal_L3 Ribosomal protein L3 83 163 0.83

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.