Protein Family IF04545
Metagenome
Isolate
456
Members
133
Samples
390
Scaffolds
247.45
Avg Length
Representative Sequence
- ID
- 3300042590|Ga0466690_259106|Ga0466690_259106_1218_2123
- Length
- 301 aa
- Sequence
- VQKCTGGFFEILKSLNFEIFKLMRSIGYLNLPPLSTFHIFLYLCSGKLKKHLHMKLLEGKTAVVTGAARGIGKAVALRLAQEGCAIAFTDLAIDGNAEKTETELLALGVKAKGYASNAAKFAETQQVIDTIVKDFGRIDILINNAGITRDGLLLRMSEEQWDAVITVNLKSAFNFTRAVAPVMVRQRSGSIVNMSSVVGVSGNAAQANYAASKAGLIGLAKSVAKELGSRGIRCNAIAPGFIITEMTHQLSGEVREKWLETIPLRRGGTPEDVANVALFLASDLSAYVSGQVIPVCGGMNA
Sample Types
Isolate
14.5%
Metagenome
85.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
26.7%
Blattidae
22.1%
Unclassified
17.6%
Kalotermitidae
10.7%
Rhinotermitidae
3.8%
Tenebrionidae
3.8%
Termopsidae
3.1%
Culicidae
2.3%
Hydrophilidae
2.3%
Passalidae
1.5%
Cambaridae
1.5%
Formicidae
1.5%
Elmidae
0.8%
Armadillidiidae
0.8%
Cerambycidae
0.8%
Hodotermitidae
0.8%
Taxonomy
Archaea
0
Bacteria
428
Eukaryota
0
Viruses
0
Unclassified
28
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 2 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 3 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 4 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 5 | 3006461590 | Streptomyces sp. RB5 | Isolate | Termitidae |
| 6 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 7 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 8 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 9 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 10 | 2820329821 | Unclassified Firmicutes Nt197P3bin77 | Isolate | Unclassified |
| 11 | 2820400448 | Unclassified Firmicutes Nc150Mbin1 | Isolate | Unclassified |
| 12 | 2862784999 | Streptomyces sp. M41 | Isolate | Unclassified |
| 13 | 2931425734 | Nocardioides sp. J2M5 | Isolate | |
| 14 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 15 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 16 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 17 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 18 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 19 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 20 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 21 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 22 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 23 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 24 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 25 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 26 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 27 | 2820882373 | Unclassified Actinobacteria Lab288P1bin45 | Isolate | Unclassified |
| 28 | 2908241010 | Streptomyces sp. HF10 | Isolate | Termitidae |
| 29 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 30 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 31 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 32 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 33 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 34 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 35 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 36 | 3006468911 | Streptomyces sp. RB17 | Isolate | Termitidae |
| 37 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 38 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 39 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 40 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 41 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 42 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 43 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 44 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 45 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 46 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 47 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 48 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 49 | 2896955351 | Streptomyces sp. GF20 | Isolate | Termitidae |
| 50 | 2910090113 | Kocuria sp. cx-116 | Isolate | Cambaridae |
| 51 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 52 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 53 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 54 | 2681812870 | Oerskovia enterophila DFA-19 | Isolate | Unclassified |
| 55 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 56 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 57 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 58 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 59 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 60 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 61 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 62 | 8053361298 | Streptomyces formicae 1H-GS9 | Isolate | Unclassified |
| 63 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 64 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 65 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 66 | 2820857933 | Unclassified Actinobacteria Lab288P3bin173 | Isolate | Unclassified |
| 67 | 2898589227 | Actinomadura macrotermitis RB68 | Isolate | Termitidae |
| 68 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 69 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 70 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 71 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 72 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 73 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 74 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 75 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 76 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 77 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 78 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 79 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 80 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 81 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 82 | 2883361506 | Luteimicrobium xylanilyticum HY-24 | Isolate | Cerambycidae |
| 83 | 2909881144 | Kocuria sp. cx-455 | Isolate | Cambaridae |
| 84 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 85 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 86 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 87 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 88 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 89 | 2547132081 | Streptomyces sp. S4 | Isolate | Formicidae |
| 90 | 2820547636 | Unclassified Firmicutes Lab288P1bin10 | Isolate | Unclassified |
| 91 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 92 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 93 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 94 | 8012935351 | Brevibacterium epidermidis UD i117 | Isolate | Unclassified |
| 95 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 96 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 97 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 98 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 99 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 100 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 101 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 102 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 103 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 104 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 105 | 2648501322 | Streptomyces sp. SA3_actF | Isolate | Unclassified |
| 106 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 107 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 108 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 109 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 110 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 111 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 112 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 113 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 114 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 115 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 116 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 117 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 118 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 119 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 120 | 2873586004 | Sanguibacter sp. HDW7 | Isolate | Hydrophilidae |
| 121 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 122 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 123 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 124 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 125 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 126 | 8077783556 | Streptomyces sp. PLM4 | Isolate | Formicidae |
| 127 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 128 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 129 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 130 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 131 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 132 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 133 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_179409 | 3300042611 | Bacteria | 152612 |
| 2 | Ga0466733_015305 | 3300042659 | Bacteria | 13906 |
| 3 | Ga0562378_0063 | 3300056814 | Bacteria | 309476 |
| 4 | Ga0466707_408706 | 3300042601 | Bacteria | 1319 |
| 5 | Ga0466719_549664 | 3300042606 | Bacteria | 4431 |
| 6 | Ga0160446_100077 | 3300012835 | Bacteria | 97363 |
| 7 | Ga0466656_138698 | 3300042550 | Bacteria | 3191 |
| 8 | Ga0466692_131029 | 3300042591 | Bacteria | 1235 |
| 9 | Ga0466693_160449 | 3300042592 | Bacteria | 1106 |
| 10 | Ga0466694_294696 | 3300042594 | Bacteria | 1942 |
| 11 | Ga0466696_112845 | 3300042596 | Bacteria | 14801 |
| 12 | Ga0466696_158124 | 3300042596 | Bacteria | 18249 |
| 13 | Ga0466696_213692 | 3300042596 | Bacteria | 9451 |
| 14 | Ga0466696_229524 | 3300042596 | Bacteria | 5434 |
| 15 | Ga0466731_135196 | 3300042622 | Bacteria | 3054 |
| 16 | Ga0466731_225820 | 3300042622 | Bacteria | 13914 |
| 17 | Ga0466731_293316 | 3300042622 | Bacteria | 4351 |
| 18 | Ga0466703_082207 | 3300042636 | Bacteria | 19739 |
| 19 | Ga0466704_138551 | 3300042643 | Bacteria | 21093 |
| 20 | Ga0466704_252890 | 3300042643 | Bacteria | 18117 |
| 21 | Ga0466704_260207 | 3300042643 | Unclassified | 6076 |
| 22 | Ga0466704_367890 | 3300042643 | Bacteria | 7284 |
| 23 | Ga0466708_120662 | 3300042652 | Bacteria | 21101 |
| 24 | Ga0466725_200108 | 3300042654 | Bacteria | 11044 |
| 25 | Ga0466727_112751 | 3300042655 | Bacteria | 7654 |
| 26 | Ga0466727_166202 | 3300042655 | Unclassified | 2807 |
| 27 | Ga0466727_282742 | 3300042655 | Bacteria | 1790 |
| 28 | Ga0466710_013416 | 3300042613 | Bacteria | 7430 |
| 29 | Ga0466711_205227 | 3300042615 | Unclassified | 2341 |
| 30 | Ga0466711_482046 | 3300042615 | Bacteria | 6846 |
| 31 | Ga0466715_008601 | 3300042616 | Bacteria | 3099 |
| 32 | Ga0466715_126416 | 3300042616 | Bacteria | 20370 |
| 33 | Ga0466723_127128 | 3300042618 | Bacteria | 32094 |
| 34 | Ga0466723_147019 | 3300042618 | Bacteria | 15302 |
| 35 | Ga0466723_197624 | 3300042618 | Bacteria | 10798 |
| 36 | Ga0123356_10057339 | 3300010049 | Bacteria | 3630 |
| 37 | Ga0123356_10650242 | 3300010049 | Bacteria | 1221 |
| 38 | Ga0123353_10184940 | 3300010167 | Bacteria | 3296 |
| 39 | Ga0123354_10138282 | 3300010882 | Bacteria | 3031 |
| 40 | Ga0068302_10002899 | 3300005071 | Bacteria | 3079 |
| 41 | Ga0466705_009950 | 3300042612 | Bacteria | 28016 |
| 42 | Ga0466705_358193 | 3300042612 | Bacteria | 48237 |
| 43 | Ga0466733_191268 | 3300042659 | Bacteria | 1691 |
| 44 | Ga0466717_101142 | 3300042604 | Bacteria | 2394 |
| 45 | Ga0466716_006669 | 3300042605 | Bacteria | 7412 |
| 46 | Ga0466716_104691 | 3300042605 | Bacteria | 9369 |
| 47 | Ga0466716_202084 | 3300042605 | Bacteria | 17568 |
| 48 | Ga0466719_072964 | 3300042606 | Bacteria | 3294 |
| 49 | Ga0466719_086818 | 3300042606 | Bacteria | 2700 |
| 50 | Ga0466719_536782 | 3300042606 | Bacteria | 22487 |
| 51 | Ga0466721_028477 | 3300042608 | Bacteria | 17239 |
| 52 | Ga0466656_063461 | 3300042550 | Bacteria | 2970 |
| 53 | Ga0466690_259106 | 3300042590 | Bacteria | 2214 |
| 54 | Ga0466693_178448 | 3300042592 | Bacteria | 2359 |
| 55 | Ga0466691_093341 | 3300042593 | Bacteria | 11456 |
| 56 | Ga0466696_180692 | 3300042596 | Bacteria | 11884 |
| 57 | Ga0466696_229651 | 3300042596 | Bacteria | 18950 |
| 58 | Ga0466699_186447 | 3300042597 | Bacteria | 1523 |
| 59 | Ga0466699_398971 | 3300042597 | Bacteria | 1670 |
| 60 | Ga0466701_007684 | 3300042598 | Bacteria | 3736 |
| 61 | Ga0466735_001257 | 3300042624 | Bacteria | 1775 |
| 62 | Ga0466735_120038 | 3300042624 | Bacteria | 5168 |
| 63 | Ga0466735_139694 | 3300042624 | Bacteria | 11932 |
| 64 | Ga0466735_145567 | 3300042624 | Unclassified | 1136 |
| 65 | Ga0466735_145663 | 3300042624 | Unclassified | 2030 |
| 66 | Ga0466730_018279 | 3300042625 | Bacteria | 1383 |
| 67 | Ga0466703_039082 | 3300042636 | Bacteria | 6933 |
| 68 | Ga0466704_256111 | 3300042643 | Bacteria | 159283 |
| 69 | Ga0466724_38572 | 3300042649 | Unclassified | 1161 |
| 70 | Ga0466727_069491 | 3300042655 | Bacteria | 6332 |
| 71 | Ga0466727_160046 | 3300042655 | Bacteria | 19595 |
| 72 | Ga0466711_062120 | 3300042615 | Bacteria | 7801 |
| 73 | Ga0466711_181287 | 3300042615 | Bacteria | 1613 |
| 74 | Ga0466715_174556 | 3300042616 | Bacteria | 12351 |
| 75 | Ga0466715_406464 | 3300042616 | Bacteria | 1532 |
| 76 | Ga0466728_022795 | 3300042620 | Bacteria | 4890 |
| 77 | Ga0466728_255251 | 3300042620 | Bacteria | 107081 |
| 78 | Ga0123357_10013181 | 3300009784 | Bacteria | 10710 |
| 79 | Ga0123355_10645211 | 3300009826 | Bacteria | 1238 |
| 80 | Ga0123353_10471815 | 3300010167 | Bacteria | 1839 |
| 81 | Ga0123353_11199449 | 3300010167 | Bacteria | 996 |
| 82 | JGI24696J40584_12913632 | 3300002834 | Bacteria | 1278 |
| 83 | Ga0123357_10001808 | 3300009784 | Bacteria | 23175 |
| 84 | Ga0466697_281102 | 3300042611 | Bacteria | 2890 |
| 85 | Ga0466705_058872 | 3300042612 | Bacteria | 5610 |
| 86 | Ga0466732_317944 | 3300042656 | Bacteria | 1509 |
| 87 | Ga0466733_010306 | 3300042659 | Bacteria | 3593 |
| 88 | Ga0466733_156031 | 3300042659 | Bacteria | 18803 |
| 89 | Ga0562379_0272 | 3300056790 | Bacteria | 134461 |
| 90 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 91 | Ga0562375_0028 | 3300056856 | Bacteria | 708255 |
| 92 | Ga0562375_3139 | 3300056856 | Bacteria | 16378 |
| 93 | Ga0562376_1353 | 3300056857 | Bacteria | 35020 |
| 94 | Ga0466700_420965 | 3300042600 | Bacteria | 1433 |
| 95 | Ga0466713_130991 | 3300042602 | Bacteria | 214088 |
| 96 | Ga0466714_038939 | 3300042603 | Bacteria | 29637 |
| 97 | Ga0466714_066858 | 3300042603 | Bacteria | 7098 |
| 98 | Ga0466716_028099 | 3300042605 | Unclassified | 2890 |
| 99 | Ga0466716_072096 | 3300042605 | Bacteria | 13449 |
| 100 | Ga0466719_242706 | 3300042606 | Bacteria | 6331 |
| 101 | Ga0466719_276396 | 3300042606 | Bacteria | 1346 |
| 102 | Ga0466697_039640 | 3300042611 | Bacteria | 2685 |
| 103 | Ga0415639_044109 | 3300038395 | Bacteria | 1958 |
| 104 | Ga0466657_094253 | 3300042582 | Bacteria | 1830 |
| 105 | Ga0466657_245653 | 3300042582 | Bacteria | 2003 |
| 106 | Ga0466690_205201 | 3300042590 | Bacteria | 2983 |
| 107 | Ga0466694_298563 | 3300042594 | Bacteria | 15427 |
| 108 | Ga0466696_035202 | 3300042596 | Bacteria | 7482 |
| 109 | Ga0466696_151019 | 3300042596 | Bacteria | 3702 |
| 110 | Ga0466696_168557 | 3300042596 | Bacteria | 4337 |
| 111 | Ga0466729_297055 | 3300042621 | Bacteria | 11394 |
| 112 | Ga0466731_168939 | 3300042622 | Bacteria | 7362 |
| 113 | Ga0466735_082206 | 3300042624 | Bacteria | 4667 |
| 114 | Ga0466730_021997 | 3300042625 | Bacteria | 3042 |
| 115 | Ga0466702_231492 | 3300042635 | Bacteria | 1110 |
| 116 | Ga0466703_028602 | 3300042636 | Bacteria | 13514 |
| 117 | Ga0466703_073524 | 3300042636 | Unclassified | 5816 |
| 118 | Ga0466704_031634 | 3300042643 | Bacteria | 25951 |
| 119 | Ga0466704_160498 | 3300042643 | Bacteria | 16644 |
| 120 | Ga0466704_566400 | 3300042643 | Bacteria | 2108 |
| 121 | Ga0466725_276656 | 3300042654 | Bacteria | 14850 |
| 122 | Ga0466712_294750 | 3300042614 | Bacteria | 2008 |
| 123 | Ga0466711_050237 | 3300042615 | Bacteria | 1023 |
| 124 | Ga0466711_171503 | 3300042615 | Bacteria | 16708 |
| 125 | Ga0466715_025032 | 3300042616 | Bacteria | 5084 |
| 126 | Ga0466715_157369 | 3300042616 | Bacteria | 2774 |
| 127 | Ga0466726_121684 | 3300042619 | Bacteria | 12626 |
| 128 | Ga0466728_193779 | 3300042620 | Bacteria | 6571 |
| 129 | Ga0123356_10046591 | 3300010049 | Bacteria | 4034 |
| 130 | Ga0123353_10006212 | 3300010167 | Bacteria | 15875 |
| 131 | Ga0123353_10919249 | 3300010167 | Bacteria | 1188 |
| 132 | IMNBL1DRAFT_c0016782 | 3300000062 | Unclassified | 3116 |
| 133 | JGI24702J35022_10018786 | 3300002462 | Bacteria | 3767 |
| 134 | JGI24702J35022_10116686 | 3300002462 | Bacteria | 1472 |
| 135 | JGI24696J40584_12961634 | 3300002834 | Bacteria | 26769 |
| 136 | Ga0466705_127502 | 3300042612 | Bacteria | 5563 |
| 137 | Ga0466732_262076 | 3300042656 | Unclassified | 1268 |
| 138 | Ga0466733_043060 | 3300042659 | Bacteria | 1570 |
| 139 | Ga0562379_0016 | 3300056790 | Bacteria | 1192610 |
| 140 | Ga0466707_238438 | 3300042601 | Bacteria | 2352 |
| 141 | Ga0466716_384143 | 3300042605 | Bacteria | 8792 |
| 142 | Ga0466719_057701 | 3300042606 | Bacteria | 4518 |
| 143 | Ga0466722_233453 | 3300042609 | Bacteria | 6938 |
| 144 | Ga0160459_100033 | 3300012831 | Bacteria | 259391 |
| 145 | Ga0466657_058083 | 3300042582 | Bacteria | 7964 |
| 146 | Ga0466690_335034 | 3300042590 | Bacteria | 18270 |
| 147 | Ga0466692_046708 | 3300042591 | Bacteria | 150257 |
| 148 | Ga0466691_063026 | 3300042593 | Unclassified | 11589 |
| 149 | Ga0466696_236814 | 3300042596 | Bacteria | 9067 |
| 150 | Ga0466735_006292 | 3300042624 | Bacteria | 2614 |
| 151 | Ga0466735_029076 | 3300042624 | Bacteria | 6064 |
| 152 | Ga0466730_017725 | 3300042625 | Bacteria | 1571 |
| 153 | Ga0466704_077113 | 3300042643 | Bacteria | 8203 |
| 154 | Ga0466704_094066 | 3300042643 | Bacteria | 24442 |
| 155 | Ga0466704_506685 | 3300042643 | Bacteria | 2993 |
| 156 | Ga0466709_332262 | 3300042648 | Bacteria | 22285 |
| 157 | Ga0466708_093778 | 3300042652 | Bacteria | 24076 |
| 158 | Ga0466708_230369 | 3300042652 | Bacteria | 1775 |
| 159 | Ga0466725_435051 | 3300042654 | Bacteria | 2372 |
| 160 | Ga0466727_017258 | 3300042655 | Bacteria | 2945 |
| 161 | Ga0466727_066312 | 3300042655 | Bacteria | 11464 |
| 162 | Ga0466727_265039 | 3300042655 | Bacteria | 8851 |
| 163 | Ga0466705_442873 | 3300042612 | Bacteria | 1102 |
| 164 | Ga0466710_138990 | 3300042613 | Bacteria | 16987 |
| 165 | Ga0466710_217344 | 3300042613 | Bacteria | 3730 |
| 166 | Ga0466711_342852 | 3300042615 | Unclassified | 2157 |
| 167 | Ga0466715_063927 | 3300042616 | Bacteria | 20242 |
| 168 | Ga0466715_412617 | 3300042616 | Bacteria | 4332 |
| 169 | Ga0466723_245484 | 3300042618 | Bacteria | 14371 |
| 170 | Ga0466723_264109 | 3300042618 | Bacteria | 26717 |
| 171 | Ga0466726_312311 | 3300042619 | Bacteria | 8010 |
| 172 | Ga0466728_188695 | 3300042620 | Bacteria | 7763 |
| 173 | Ga0123355_10158442 | 3300009826 | Bacteria | 3418 |
| 174 | Ga0123356_10019732 | 3300010049 | Bacteria | 6389 |
| 175 | Ga0123353_11213583 | 3300010167 | Bacteria | 988 |
| 176 | Ga0068305_10002753 | 3300005083 | Bacteria | 27852 |
| 177 | Ga0072941_1049145 | 3300005201 | Bacteria | 4622 |
| 178 | Ga0072941_1089947 | 3300005201 | Bacteria | 1745 |
| 179 | Ga0466705_336950 | 3300042612 | Bacteria | 3391 |
| 180 | Ga0466733_037469 | 3300042659 | Bacteria | 7623 |
| 181 | Ga0562375_0308 | 3300056856 | Bacteria | 120515 |
| 182 | Ga0466707_079940 | 3300042601 | Bacteria | 11082 |
| 183 | Ga0466707_115176 | 3300042601 | Bacteria | 1756 |
| 184 | Ga0466713_016019 | 3300042602 | Bacteria | 439221 |
| 185 | Ga0466713_066167 | 3300042602 | Bacteria | 11539 |
| 186 | Ga0466713_140837 | 3300042602 | Bacteria | 175760 |
| 187 | Ga0466714_008699 | 3300042603 | Bacteria | 1802 |
| 188 | Ga0466714_055139 | 3300042603 | Bacteria | 5718 |
| 189 | Ga0466714_070265 | 3300042603 | Bacteria | 9050 |
| 190 | Ga0466714_164817 | 3300042603 | Bacteria | 1009 |
| 191 | Ga0466716_101111 | 3300042605 | Bacteria | 10329 |
| 192 | Ga0466716_345327 | 3300042605 | Bacteria | 3123 |
| 193 | Ga0466716_379769 | 3300042605 | Bacteria | 2816 |
| 194 | Ga0466722_152891 | 3300042609 | Bacteria | 26871 |
| 195 | Ga0466722_205722 | 3300042609 | Bacteria | 13113 |
| 196 | Ga0466690_019112 | 3300042590 | Bacteria | 15401 |
| 197 | Ga0466690_160469 | 3300042590 | Bacteria | 15377 |
| 198 | Ga0466690_222263 | 3300042590 | Bacteria | 2753 |
| 199 | Ga0466691_052134 | 3300042593 | Bacteria | 12667 |
| 200 | Ga0466691_055638 | 3300042593 | Bacteria | 18379 |
| 201 | Ga0466694_271774 | 3300042594 | Bacteria | 8810 |
| 202 | Ga0466696_342181 | 3300042596 | Bacteria | 3314 |
| 203 | Ga0466696_368802 | 3300042596 | Bacteria | 221772 |
| 204 | Ga0466699_369934 | 3300042597 | Bacteria | 2490 |
| 205 | Ga0466703_096920 | 3300042636 | Bacteria | 5212 |
| 206 | Ga0466703_228860 | 3300042636 | Bacteria | 11038 |
| 207 | Ga0466703_331732 | 3300042636 | Bacteria | 9966 |
| 208 | Ga0466708_068773 | 3300042652 | Bacteria | 15534 |
| 209 | Ga0466708_140275 | 3300042652 | Bacteria | 9075 |
| 210 | Ga0466708_163650 | 3300042652 | Bacteria | 19190 |
| 211 | Ga0466727_257339 | 3300042655 | Bacteria | 5734 |
| 212 | Ga0466710_049640 | 3300042613 | Bacteria | 8303 |
| 213 | Ga0466711_010541 | 3300042615 | Bacteria | 14290 |
| 214 | Ga0466715_027253 | 3300042616 | Bacteria | 4664 |
| 215 | Ga0466715_301663 | 3300042616 | Bacteria | 14528 |
| 216 | Ga0466723_089568 | 3300042618 | Bacteria | 54083 |
| 217 | Ga0466723_200153 | 3300042618 | Bacteria | 4962 |
| 218 | Ga0466726_054164 | 3300042619 | Bacteria | 12058 |
| 219 | Ga0466726_300403 | 3300042619 | Bacteria | 11532 |
| 220 | Ga0466728_109015 | 3300042620 | Bacteria | 4195 |
| 221 | Ga0123357_10086790 | 3300009784 | Bacteria | 4094 |
| 222 | Ga0123355_10001640 | 3300009826 | Bacteria | 31192 |
| 223 | Ga0123355_10163045 | 3300009826 | Bacteria | 3353 |
| 224 | Ga0123356_10705580 | 3300010049 | Bacteria | 1178 |
| 225 | Ga0123353_10026194 | 3300010167 | Bacteria | 8900 |
| 226 | Ga0123353_10092381 | 3300010167 | Bacteria | 4876 |
| 227 | Ga0123353_10201187 | 3300010167 | Bacteria | 3133 |
| 228 | Ga0123353_10626719 | 3300010167 | Bacteria | 1529 |
| 229 | 2227632943 | 2225789004 | Bacteria | 11346 |
| 230 | IMNBL1DRAFT_c0006540 | 3300000062 | Bacteria | 6345 |
| 231 | IMNBL1DRAFT_c0019010 | 3300000062 | Bacteria | 2832 |
| 232 | JGI24705J35276_12237033 | 3300002504 | Bacteria | 9627 |
| 233 | Ga0072941_1096569 | 3300005201 | Bacteria | 1413 |
| 234 | Ga0466705_327059 | 3300042612 | Bacteria | 16178 |
| 235 | Ga0466733_179925 | 3300042659 | Unclassified | 2887 |
| 236 | Ga0466701_058247 | 3300042598 | Bacteria | 3097 |
| 237 | Ga0466706_026420 | 3300042599 | Bacteria | 1926 |
| 238 | Ga0466707_022769 | 3300042601 | Bacteria | 2376 |
| 239 | Ga0466707_284476 | 3300042601 | Bacteria | 5384 |
| 240 | Ga0466719_162727 | 3300042606 | Bacteria | 34676 |
| 241 | Ga0466722_196132 | 3300042609 | Bacteria | 1082 |
| 242 | Ga0466698_137628 | 3300042610 | Bacteria | 3066 |
| 243 | Ga0160434_106179 | 3300012850 | Bacteria | 1976 |
| 244 | Ga0415639_123232 | 3300038395 | Bacteria | 1022 |
| 245 | Ga0415639_281455 | 3300038395 | Bacteria | 966 |
| 246 | Ga0466690_069643 | 3300042590 | Bacteria | 3221 |
| 247 | Ga0466690_092237 | 3300042590 | Bacteria | 50238 |
| 248 | Ga0466690_163094 | 3300042590 | Bacteria | 9561 |
| 249 | Ga0466690_175771 | 3300042590 | Bacteria | 56622 |
| 250 | Ga0466692_029164 | 3300042591 | Bacteria | 9584 |
| 251 | Ga0466692_094333 | 3300042591 | Bacteria | 1436 |
| 252 | Ga0466691_044534 | 3300042593 | Bacteria | 10547 |
| 253 | Ga0466691_045386 | 3300042593 | Bacteria | 31904 |
| 254 | Ga0466691_168903 | 3300042593 | Bacteria | 4832 |
| 255 | Ga0466696_072321 | 3300042596 | Bacteria | 1225 |
| 256 | Ga0466696_172451 | 3300042596 | Bacteria | 2473 |
| 257 | Ga0466696_432602 | 3300042596 | Bacteria | 17624 |
| 258 | Ga0466729_272117 | 3300042621 | Bacteria | 2011 |
| 259 | Ga0466735_205360 | 3300042624 | Bacteria | 3003 |
| 260 | Ga0466730_018555 | 3300042625 | Bacteria | 2728 |
| 261 | Ga0466730_030898 | 3300042625 | Bacteria | 17625 |
| 262 | Ga0466703_099532 | 3300042636 | Bacteria | 11615 |
| 263 | Ga0466704_052038 | 3300042643 | Bacteria | 8405 |
| 264 | Ga0466704_082975 | 3300042643 | Bacteria | 3394 |
| 265 | Ga0466704_522913 | 3300042643 | Unclassified | 8833 |
| 266 | Ga0466709_169723 | 3300042648 | Bacteria | 216757 |
| 267 | Ga0466708_297652 | 3300042652 | Bacteria | 42408 |
| 268 | Ga0466725_446610 | 3300042654 | Bacteria | 5932 |
| 269 | Ga0466727_102231 | 3300042655 | Bacteria | 4825 |
| 270 | Ga0466710_074496 | 3300042613 | Bacteria | 1040 |
| 271 | Ga0466710_170124 | 3300042613 | Bacteria | 2047 |
| 272 | Ga0466711_195207 | 3300042615 | Bacteria | 7233 |
| 273 | Ga0466711_217459 | 3300042615 | Bacteria | 9140 |
| 274 | Ga0466711_343739 | 3300042615 | Unclassified | 1676 |
| 275 | Ga0466723_229815 | 3300042618 | Bacteria | 11904 |
| 276 | Ga0466726_186563 | 3300042619 | Bacteria | 2129 |
| 277 | Ga0466728_023238 | 3300042620 | Bacteria | 7234 |
| 278 | Ga0466729_179941 | 3300042621 | Bacteria | 7967 |
| 279 | Ga0123353_10296971 | 3300010167 | Unclassified | 2469 |
| 280 | Ga0123354_10207703 | 3300010882 | Bacteria | 2128 |
| 281 | 2227471874 | 2225789004 | Bacteria | 4842 |
| 282 | Ga0068305_10002944 | 3300005083 | Bacteria | 22660 |
| 283 | Ga0466705_062995 | 3300042612 | Unclassified | 30508 |
| 284 | Ga0466705_335658 | 3300042612 | Bacteria | 24109 |
| 285 | Ga0466733_158160 | 3300042659 | Bacteria | 3134 |
| 286 | Ga0466733_173875 | 3300042659 | Unclassified | 19900 |
| 287 | Ga0466733_195509 | 3300042659 | Bacteria | 83582 |
| 288 | Ga0562376_0027 | 3300056857 | Bacteria | 397453 |
| 289 | Ga0466701_101352 | 3300042598 | Bacteria | 1337 |
| 290 | Ga0466706_025047 | 3300042599 | Bacteria | 5815 |
| 291 | Ga0466706_055892 | 3300042599 | Bacteria | 3989 |
| 292 | Ga0466706_086623 | 3300042599 | Bacteria | 12385 |
| 293 | Ga0466706_126206 | 3300042599 | Bacteria | 1982 |
| 294 | Ga0466707_055970 | 3300042601 | Bacteria | 3882 |
| 295 | Ga0466713_074804 | 3300042602 | Unclassified | 8096 |
| 296 | Ga0466714_073987 | 3300042603 | Bacteria | 2374 |
| 297 | Ga0466716_451314 | 3300042605 | Bacteria | 8977 |
| 298 | Ga0466722_252037 | 3300042609 | Bacteria | 13732 |
| 299 | Ga0160446_103801 | 3300012835 | Bacteria | 2326 |
| 300 | Ga0466657_154882 | 3300042582 | Bacteria | 1544 |
| 301 | Ga0466693_105310 | 3300042592 | Bacteria | 8132 |
| 302 | Ga0466691_053426 | 3300042593 | Bacteria | 18625 |
| 303 | Ga0466696_096834 | 3300042596 | Bacteria | 8275 |
| 304 | Ga0466696_274194 | 3300042596 | Bacteria | 9483 |
| 305 | Ga0466735_003832 | 3300042624 | Bacteria | 6317 |
| 306 | Ga0466730_068726 | 3300042625 | Unclassified | 4025 |
| 307 | Ga0466703_160265 | 3300042636 | Bacteria | 23736 |
| 308 | Ga0466703_383204 | 3300042636 | Bacteria | 8930 |
| 309 | Ga0466704_055670 | 3300042643 | Bacteria | 9312 |
| 310 | Ga0466704_299961 | 3300042643 | Bacteria | 1698 |
| 311 | Ga0466709_270051 | 3300042648 | Unclassified | 1360 |
| 312 | Ga0466709_330726 | 3300042648 | Bacteria | 8260 |
| 313 | Ga0466709_389545 | 3300042648 | Bacteria | 2361 |
| 314 | Ga0466708_190941 | 3300042652 | Unclassified | 1491 |
| 315 | Ga0466708_440707 | 3300042652 | Bacteria | 7881 |
| 316 | Ga0466705_467409 | 3300042612 | Bacteria | 6504 |
| 317 | Ga0466711_133857 | 3300042615 | Bacteria | 10252 |
| 318 | Ga0466711_176340 | 3300042615 | Bacteria | 4966 |
| 319 | Ga0466711_239548 | 3300042615 | Bacteria | 5626 |
| 320 | Ga0466715_358302 | 3300042616 | Bacteria | 1096 |
| 321 | Ga0466723_137213 | 3300042618 | Bacteria | 27651 |
| 322 | Ga0466723_270766 | 3300042618 | Bacteria | 18832 |
| 323 | Ga0466726_225420 | 3300042619 | Bacteria | 2612 |
| 324 | Ga0123355_10040253 | 3300009826 | Bacteria | 7607 |
| 325 | Ga0123355_10079149 | 3300009826 | Bacteria | 5250 |
| 326 | Ga0123355_10444516 | 3300009826 | Bacteria | 1639 |
| 327 | Ga0123356_10012249 | 3300010049 | Bacteria | 8332 |
| 328 | Ga0123356_10395155 | 3300010049 | Bacteria | 1519 |
| 329 | Ga0123353_10031425 | 3300010167 | Bacteria | 8224 |
| 330 | Ga0123353_10646884 | 3300010167 | Bacteria | 1498 |
| 331 | Ga0123354_10053524 | 3300010882 | Bacteria | 6070 |
| 332 | 2227241906 | 2225789004 | Bacteria | 7231 |
| 333 | IMNBL1DRAFT_c0001624 | 3300000062 | Bacteria | 16660 |
| 334 | IMNBL1DRAFT_c0002018 | 3300000062 | Bacteria | 14545 |
| 335 | JGI24702J35022_10009165 | 3300002462 | Bacteria | 5568 |
| 336 | JGI24702J35022_10012760 | 3300002462 | Bacteria | 4663 |
| 337 | JGI24696J40584_12924219 | 3300002834 | Bacteria | 1385 |
| 338 | JGI24696J40584_12961016 | 3300002834 | Bacteria | 10006 |
| 339 | Ga0072941_1122649 | 3300005201 | Bacteria | 8201 |
| 340 | Ga0072941_1603838 | 3300005201 | Bacteria | 1103 |
| 341 | Ga0466697_237892 | 3300042611 | Bacteria | 1484 |
| 342 | Ga0466705_370120 | 3300042612 | Bacteria | 6275 |
| 343 | Ga0466733_094700 | 3300042659 | Unclassified | 12072 |
| 344 | Ga0466733_124297 | 3300042659 | Unclassified | 21773 |
| 345 | Ga0562379_4622 | 3300056790 | Unclassified | 6583 |
| 346 | Ga0562375_3097 | 3300056856 | Bacteria | 16566 |
| 347 | Ga0466701_025940 | 3300042598 | Bacteria | 2541 |
| 348 | Ga0466701_098080 | 3300042598 | Bacteria | 65896 |
| 349 | Ga0466713_013942 | 3300042602 | Bacteria | 36823 |
| 350 | Ga0466713_032206 | 3300042602 | Bacteria | 1293 |
| 351 | Ga0466713_061789 | 3300042602 | Bacteria | 88378 |
| 352 | Ga0466713_065618 | 3300042602 | Bacteria | 11302 |
| 353 | Ga0466713_145405 | 3300042602 | Bacteria | 30268 |
| 354 | Ga0466722_239940 | 3300042609 | Bacteria | 60486 |
| 355 | Ga0466722_242007 | 3300042609 | Bacteria | 3724 |
| 356 | Ga0160457_1000016 | 3300012858 | Bacteria | 412496 |
| 357 | Ga0415639_276960 | 3300038395 | Bacteria | 1078 |
| 358 | Ga0466657_374794 | 3300042582 | Unclassified | 11545 |
| 359 | Ga0466690_033320 | 3300042590 | Bacteria | 22951 |
| 360 | Ga0466735_042154 | 3300042624 | Bacteria | 1289 |
| 361 | Ga0466703_173450 | 3300042636 | Unclassified | 1838 |
| 362 | Ga0466703_242786 | 3300042636 | Bacteria | 1227 |
| 363 | Ga0466703_339908 | 3300042636 | Bacteria | 9891 |
| 364 | Ga0466703_396871 | 3300042636 | Bacteria | 1216 |
| 365 | Ga0466708_044312 | 3300042652 | Bacteria | 69817 |
| 366 | Ga0466725_047618 | 3300042654 | Bacteria | 4406 |
| 367 | Ga0466710_373530 | 3300042613 | Bacteria | 1007 |
| 368 | Ga0466711_303779 | 3300042615 | Bacteria | 18039 |
| 369 | Ga0466711_373737 | 3300042615 | Bacteria | 78112 |
| 370 | Ga0466715_171616 | 3300042616 | Unclassified | 1178 |
| 371 | Ga0466715_211286 | 3300042616 | Bacteria | 28788 |
| 372 | Ga0466715_296490 | 3300042616 | Bacteria | 2821 |
| 373 | Ga0466715_307061 | 3300042616 | Bacteria | 9015 |
| 374 | Ga0466715_458768 | 3300042616 | Bacteria | 71878 |
| 375 | Ga0466715_581537 | 3300042616 | Bacteria | 21882 |
| 376 | Ga0466715_594337 | 3300042616 | Bacteria | 3791 |
| 377 | Ga0466726_388892 | 3300042619 | Bacteria | 1311 |
| 378 | Ga0123355_10021776 | 3300009826 | Bacteria | 10266 |
| 379 | Ga0123356_11078957 | 3300010049 | Bacteria | 972 |
| 380 | Ga0123353_10000162 | 3300010167 | Bacteria | 85033 |
| 381 | Ga0123354_10122530 | 3300010882 | Bacteria | 3346 |
| 382 | IMNBL1DRAFT_c0056171 | 3300000062 | Bacteria | 1209 |
| 383 | JGI24702J35022_10002991 | 3300002462 | Bacteria | 10230 |
| 384 | JGI24702J35022_10040189 | 3300002462 | Bacteria | 2494 |
| 385 | JGI24702J35022_10041330 | 3300002462 | Bacteria | 2458 |
| 386 | JGI24702J35022_10179153 | 3300002462 | Bacteria | 1203 |
| 387 | JGI24705J35276_12208309 | 3300002504 | Bacteria | 1769 |
| 388 | Ga0068305_10023860 | 3300005083 | Bacteria | 5275 |
| 389 | Ga0068305_10030513 | 3300005083 | Bacteria | 9366 |
| 390 | Ga0068305_10238999 | 3300005083 | Bacteria | 5937 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.