Protein Family IF04517
Metagenome
Metatranscriptome
Isolate
172
Members
43
Samples
169
Scaffolds
210.02
Avg Length
Representative Sequence
- ID
- 3300042590|Ga0466690_174707|Ga0466690_174707_307_1008
- Length
- 233 aa
- Sequence
- MPAVRRVEVYNDNHNIERNEEKRMSKIADVKQKVEAGKLREIEAVVKEALDAGDDPLAILNEGMIAAMGVVGAKFQKGDIFVPEMLIAAKTMKKGVEVLKPKLAAGATTSLGTCIIGTVHGDLHDIGKNLVALMIESAGFKMIDLGVDVPVVTFIDTIKANPDTKIVALSALLTTTMPAMKETAEAIKASGLAGFKLIVGGAPINQQFANEIGADGYSEDAASAAALAQRLAA
Sample Types
Isolate
1.2%
Metagenome
97.1%
MAG
0.0%
Metatranscriptome
1.7%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
35.0%
Kalotermitidae
32.5%
Unclassified
12.5%
Rhinotermitidae
10.0%
Termopsidae
7.5%
Hodotermitidae
2.5%
Taxonomy
Archaea
2
Bacteria
151
Eukaryota
0
Viruses
0
Unclassified
19
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 2 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 3 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 4 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 5 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 6 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 7 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 8 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 9 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 10 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 11 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 12 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 13 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 14 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 15 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 16 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 17 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 18 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 19 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 20 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 21 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 22 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 23 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 24 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 25 | 3300021232 | Termite gut microbial communities from nest from French Guiana - FG16_14_4 mRNA SA | Metatranscriptome | |
| 26 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 27 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 28 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 29 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 30 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 31 | 3300021192 | Termite gut microbial communities from nest - French Guiana - 5_4 mRNA SA | Metatranscriptome | Termitidae |
| 32 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 33 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 34 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 35 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 36 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 37 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 38 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 39 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 40 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 41 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 42 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 43 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_052426 | 3300042656 | Bacteria | 4206 |
| 2 | Ga0456237_0000895 | 3300041968 | Unclassified | 4679 |
| 3 | Ga0466690_320897 | 3300042590 | Bacteria | 10291 |
| 4 | Ga0466694_063015 | 3300042594 | Unclassified | 1300 |
| 5 | Ga0466696_008625 | 3300042596 | Bacteria | 1365 |
| 6 | Ga0466707_367052 | 3300042601 | Bacteria | 4456 |
| 7 | Ga0466722_020660 | 3300042609 | Bacteria | 2799 |
| 8 | Ga0466718_054645 | 3300042617 | Bacteria | 1691 |
| 9 | Ga0466726_073172 | 3300042619 | Bacteria | 1711 |
| 10 | Ga0466726_334931 | 3300042619 | Bacteria | 11384 |
| 11 | Ga0466726_454140 | 3300042619 | Bacteria | 1765 |
| 12 | Ga0466703_059260 | 3300042636 | Bacteria | 9763 |
| 13 | Ga0466704_112993 | 3300042643 | Bacteria | 6074 |
| 14 | Ga0466704_379758 | 3300042643 | Bacteria | 2242 |
| 15 | Ga0466708_160510 | 3300042652 | Bacteria | 3704 |
| 16 | Ga0466727_008885 | 3300042655 | Bacteria | 12038 |
| 17 | Ga0466727_179158 | 3300042655 | Bacteria | 1908 |
| 18 | Ga0466694_013022 | 3300042594 | Bacteria | 2712 |
| 19 | Ga0123353_10343253 | 3300010167 | Bacteria | 2254 |
| 20 | Ga0466706_016244 | 3300042599 | Bacteria | 1200 |
| 21 | Ga0466706_228642 | 3300042599 | Bacteria | 1248 |
| 22 | Ga0466707_022973 | 3300042601 | Bacteria | 1140 |
| 23 | Ga0466720_218828 | 3300042607 | Bacteria | 7644 |
| 24 | Ga0466722_102674 | 3300042609 | Bacteria | 2275 |
| 25 | JGI24702J35022_10017503 | 3300002462 | Bacteria | 3914 |
| 26 | Ga0466705_417791 | 3300042612 | Bacteria | 1020 |
| 27 | Ga0466718_088639 | 3300042617 | Bacteria | 11245 |
| 28 | Ga0466726_007766 | 3300042619 | Bacteria | 1242 |
| 29 | Ga0466726_482550 | 3300042619 | Bacteria | 12966 |
| 30 | Ga0466728_397892 | 3300042620 | Bacteria | 13110 |
| 31 | Ga0466728_403415 | 3300042620 | Bacteria | 6006 |
| 32 | Ga0466728_440181 | 3300042620 | Bacteria | 1219 |
| 33 | Ga0466703_053277 | 3300042636 | Bacteria | 8610 |
| 34 | Ga0466703_269679 | 3300042636 | Bacteria | 7039 |
| 35 | Ga0466705_106750 | 3300042612 | Bacteria | 3050 |
| 36 | Ga0466705_384510 | 3300042612 | Unclassified | 3637 |
| 37 | Ga0466732_086186 | 3300042656 | Bacteria | 1561 |
| 38 | Ga0466690_019517 | 3300042590 | Bacteria | 3387 |
| 39 | Ga0466691_017569 | 3300042593 | Bacteria | 29731 |
| 40 | Ga0466694_340160 | 3300042594 | Bacteria | 2020 |
| 41 | Ga0466696_484211 | 3300042596 | Bacteria | 1510 |
| 42 | Ga0466707_021707 | 3300042601 | Bacteria | 1609 |
| 43 | Ga0466707_314663 | 3300042601 | Bacteria | 2828 |
| 44 | Ga0466716_329988 | 3300042605 | Bacteria | 3275 |
| 45 | Ga0466719_140018 | 3300042606 | Bacteria | 3720 |
| 46 | Ga0466719_275636 | 3300042606 | Bacteria | 2350 |
| 47 | Ga0466719_354701 | 3300042606 | Unclassified | 3574 |
| 48 | Ga0466719_467301 | 3300042606 | Bacteria | 3343 |
| 49 | Ga0466698_484007 | 3300042610 | Bacteria | 1809 |
| 50 | Ga0068305_10023389 | 3300005083 | Bacteria | 12605 |
| 51 | Ga0466711_413349 | 3300042615 | Bacteria | 1603 |
| 52 | Ga0466715_161310 | 3300042616 | Bacteria | 19000 |
| 53 | Ga0466718_030638 | 3300042617 | Bacteria | 1934 |
| 54 | Ga0466723_291340 | 3300042618 | Bacteria | 16931 |
| 55 | Ga0466726_104514 | 3300042619 | Bacteria | 4024 |
| 56 | Ga0466726_137378 | 3300042619 | Bacteria | 5117 |
| 57 | Ga0466726_153447 | 3300042619 | Bacteria | 1342 |
| 58 | Ga0466726_384386 | 3300042619 | Bacteria | 2048 |
| 59 | Ga0466728_026242 | 3300042620 | Bacteria | 2572 |
| 60 | Ga0466703_059882 | 3300042636 | Unclassified | 1587 |
| 61 | Ga0466703_267854 | 3300042636 | Unclassified | 3147 |
| 62 | Ga0466703_330957 | 3300042636 | Bacteria | 1846 |
| 63 | Ga0466704_037986 | 3300042643 | Bacteria | 3123 |
| 64 | Ga0466704_408015 | 3300042643 | Bacteria | 1402 |
| 65 | Ga0466705_047521 | 3300042612 | Bacteria | 10379 |
| 66 | Ga0466705_219243 | 3300042612 | Bacteria | 3116 |
| 67 | Ga0222432_1059751 | 3300021192 | Bacteria | 815 |
| 68 | Ga0264413_113165 | 3300024493 | Bacteria | 5314 |
| 69 | Ga0466690_027793 | 3300042590 | Bacteria | 2512 |
| 70 | Ga0466691_154986 | 3300042593 | Bacteria | 1453 |
| 71 | Ga0466694_241711 | 3300042594 | Unclassified | 1522 |
| 72 | Ga0466707_005236 | 3300042601 | Archaea | 1088 |
| 73 | Ga0466707_073231 | 3300042601 | Bacteria | 8019 |
| 74 | Ga0466707_196668 | 3300042601 | Bacteria | 1466 |
| 75 | Ga0466719_006492 | 3300042606 | Bacteria | 3381 |
| 76 | Ga0466719_522447 | 3300042606 | Bacteria | 3360 |
| 77 | Ga0466719_543083 | 3300042606 | Bacteria | 1517 |
| 78 | Ga0466720_085390 | 3300042607 | Bacteria | 10435 |
| 79 | Ga0466720_156510 | 3300042607 | Unclassified | 2338 |
| 80 | Ga0466720_177676 | 3300042607 | Bacteria | 91443 |
| 81 | Ga0068305_10800173 | 3300005083 | Bacteria | 2497 |
| 82 | Ga0074263_114269 | 3300005485 | Unclassified | 1881 |
| 83 | Ga0466712_305917 | 3300042614 | Unclassified | 1570 |
| 84 | Ga0466723_008769 | 3300042618 | Bacteria | 14735 |
| 85 | Ga0466726_237575 | 3300042619 | Bacteria | 1025 |
| 86 | Ga0466728_152745 | 3300042620 | Bacteria | 2327 |
| 87 | Ga0466728_237030 | 3300042620 | Bacteria | 1346 |
| 88 | Ga0466728_237167 | 3300042620 | Bacteria | 1690 |
| 89 | Ga0466729_057783 | 3300042621 | Bacteria | 2047 |
| 90 | Ga0466735_033360 | 3300042624 | Bacteria | 1841 |
| 91 | Ga0466703_313318 | 3300042636 | Bacteria | 10125 |
| 92 | Ga0466708_217427 | 3300042652 | Bacteria | 1973 |
| 93 | Ga0466708_259087 | 3300042652 | Unclassified | 1651 |
| 94 | Ga0466727_000758 | 3300042655 | Bacteria | 1391 |
| 95 | Ga0466727_224195 | 3300042655 | Unclassified | 3322 |
| 96 | Ga0466705_264502 | 3300042612 | Bacteria | 4494 |
| 97 | Ga0466705_348785 | 3300042612 | Bacteria | 46858 |
| 98 | Ga0466690_174707 | 3300042590 | Bacteria | 3370 |
| 99 | Ga0466694_088074 | 3300042594 | Archaea | 2809 |
| 100 | Ga0466696_504362 | 3300042596 | Unclassified | 2051 |
| 101 | Ga0466707_084551 | 3300042601 | Bacteria | 4012 |
| 102 | Ga0466707_200078 | 3300042601 | Bacteria | 1354 |
| 103 | Ga0466720_019514 | 3300042607 | Bacteria | 16736 |
| 104 | Ga0466720_071022 | 3300042607 | Bacteria | 6132 |
| 105 | Ga0466720_112370 | 3300042607 | Bacteria | 5338 |
| 106 | Ga0466698_368918 | 3300042610 | Bacteria | 4054 |
| 107 | Ga0466726_490098 | 3300042619 | Bacteria | 1203 |
| 108 | Ga0466728_221429 | 3300042620 | Unclassified | 2509 |
| 109 | Ga0466728_228894 | 3300042620 | Bacteria | 1467 |
| 110 | Ga0466729_271487 | 3300042621 | Bacteria | 1164 |
| 111 | Ga0466731_183122 | 3300042622 | Bacteria | 1314 |
| 112 | Ga0466703_087047 | 3300042636 | Bacteria | 15166 |
| 113 | Ga0466704_425682 | 3300042643 | Unclassified | 2499 |
| 114 | Ga0466708_125344 | 3300042652 | Bacteria | 26258 |
| 115 | Ga0466705_039690 | 3300042612 | Bacteria | 1698 |
| 116 | Ga0264413_124715 | 3300024493 | Bacteria | 4549 |
| 117 | Ga0466691_166897 | 3300042593 | Unclassified | 4134 |
| 118 | Ga0466696_291496 | 3300042596 | Bacteria | 1975 |
| 119 | Ga0466707_317967 | 3300042601 | Bacteria | 1291 |
| 120 | Ga0466713_082530 | 3300042602 | Bacteria | 55628 |
| 121 | Ga0466715_644180 | 3300042616 | Bacteria | 12271 |
| 122 | Ga0466726_112840 | 3300042619 | Bacteria | 1105 |
| 123 | Ga0466731_021672 | 3300042622 | Bacteria | 1416 |
| 124 | Ga0466735_013149 | 3300042624 | Bacteria | 8529 |
| 125 | Ga0466704_069051 | 3300042643 | Bacteria | 8199 |
| 126 | Ga0466708_143801 | 3300042652 | Bacteria | 8346 |
| 127 | Ga0466727_340643 | 3300042655 | Bacteria | 1005 |
| 128 | Ga0223676_1004438 | 3300021232 | Bacteria | 839 |
| 129 | Ga0255786_1009959 | 3300022815 | Bacteria | 725 |
| 130 | Ga0264413_101643 | 3300024493 | Bacteria | 5882 |
| 131 | Ga0466692_036252 | 3300042591 | Bacteria | 5161 |
| 132 | Ga0466691_054957 | 3300042593 | Bacteria | 19272 |
| 133 | Ga0466694_175728 | 3300042594 | Bacteria | 1447 |
| 134 | Ga0466706_086910 | 3300042599 | Bacteria | 2125 |
| 135 | Ga0466716_120825 | 3300042605 | Bacteria | 13346 |
| 136 | Ga0466716_506885 | 3300042605 | Bacteria | 2720 |
| 137 | Ga0466720_053017 | 3300042607 | Bacteria | 6112 |
| 138 | Ga0466720_079683 | 3300042607 | Bacteria | 44811 |
| 139 | Ga0466722_210958 | 3300042609 | Bacteria | 12423 |
| 140 | JGI24698J34947_10001670 | 3300002449 | Bacteria | 11846 |
| 141 | Ga0072940_1016603 | 3300005200 | Bacteria | 6605 |
| 142 | Ga0072940_1147628 | 3300005200 | Bacteria | 1168 |
| 143 | Ga0072941_1104280 | 3300005201 | Unclassified | 1480 |
| 144 | Ga0466711_143067 | 3300042615 | Bacteria | 38768 |
| 145 | Ga0466723_061981 | 3300042618 | Bacteria | 11378 |
| 146 | Ga0466723_151504 | 3300042618 | Bacteria | 33081 |
| 147 | Ga0466729_244141 | 3300042621 | Bacteria | 2348 |
| 148 | Ga0466704_180845 | 3300042643 | Bacteria | 6246 |
| 149 | Ga0466704_542416 | 3300042643 | Bacteria | 2518 |
| 150 | Ga0466708_176763 | 3300042652 | Bacteria | 6166 |
| 151 | Ga0466727_015187 | 3300042655 | Bacteria | 11926 |
| 152 | Ga0466727_299830 | 3300042655 | Bacteria | 1012 |
| 153 | Ga0466727_348056 | 3300042655 | Bacteria | 3346 |
| 154 | Ga0466732_297309 | 3300042656 | Bacteria | 1818 |
| 155 | Ga0466690_032717 | 3300042590 | Unclassified | 4804 |
| 156 | Ga0466692_157643 | 3300042591 | Bacteria | 1573 |
| 157 | Ga0466691_016386 | 3300042593 | Bacteria | 2194 |
| 158 | Ga0466706_022731 | 3300042599 | Bacteria | 1313 |
| 159 | Ga0466722_233358 | 3300042609 | Bacteria | 3497 |
| 160 | Ga0466705_414517 | 3300042612 | Bacteria | 3495 |
| 161 | Ga0466712_268731 | 3300042614 | Unclassified | 1009 |
| 162 | Ga0466715_018103 | 3300042616 | Bacteria | 27929 |
| 163 | Ga0466723_338440 | 3300042618 | Bacteria | 7204 |
| 164 | Ga0466726_154863 | 3300042619 | Bacteria | 8398 |
| 165 | Ga0466728_103444 | 3300042620 | Bacteria | 2379 |
| 166 | Ga0466728_262516 | 3300042620 | Bacteria | 5056 |
| 167 | Ga0466729_204222 | 3300042621 | Bacteria | 1154 |
| 168 | Ga0466708_233710 | 3300042652 | Bacteria | 5266 |
| 169 | Ga0466727_340034 | 3300042655 | Bacteria | 2638 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.