Protein Family IF04427
Metagenome
Isolate
200
Members
62
Samples
184
Scaffolds
188.15
Avg Length
Representative Sequence
- ID
- 3300042582|Ga0466657_296737|Ga0466657_296737_639_1337
- Length
- 232 aa
- Sequence
- LALAFSRWHKQVSEMPTTKRKTKYMHVAFGIGSFCHCQKLTAKATKMKYLIVGLGNIGPGYADTRHNIGFMVLDALAKASNTVFADKRYGFVAEIRLRNKQLVLLKPSTFMNLSGNAIRYWLQKENIPNENLLVVVDDLALPFGALRLKPKGSDAGHNGLRHIQDLIGQNYARLRFGIGSDFPRGHQSDYVLDAFSDEEQKVLPARIELAVDIIRSFCLAGVNVTMNQYNNK
Sample Types
Isolate
8.0%
Metagenome
92.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
31.1%
Kalotermitidae
23.0%
Blattidae
18.0%
Unclassified
9.8%
Rhinotermitidae
8.2%
Passalidae
3.3%
Termopsidae
3.3%
Hodotermitidae
1.6%
Drosophilidae
1.6%
Taxonomy
Archaea
2
Bacteria
187
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 4 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 5 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 6 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 7 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 8 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 9 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 10 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 11 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 14 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 15 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 16 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 17 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 18 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 19 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 20 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 21 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 22 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 23 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 24 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 25 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 26 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 27 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 28 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 29 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 30 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 31 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 32 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 33 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 34 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 35 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 36 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 37 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 38 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 39 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 40 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 41 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 42 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 43 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 44 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 45 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 46 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 47 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 48 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 49 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 50 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 51 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 52 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 53 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 54 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 55 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 56 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 57 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 58 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 59 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 60 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 61 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 62 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_099969 | 3300042612 | Bacteria | 49190 |
| 2 | Ga0466705_112896 | 3300042612 | Bacteria | 6237 |
| 3 | Ga0466705_181557 | 3300042612 | Bacteria | 2940 |
| 4 | Ga0466733_148277 | 3300042659 | Bacteria | 18385 |
| 5 | Ga0068305_10073001 | 3300005083 | Bacteria | 12202 |
| 6 | Ga0068305_10100602 | 3300005083 | Bacteria | 14088 |
| 7 | Ga0123356_12070408 | 3300010049 | Bacteria | 710 |
| 8 | Ga0466703_047396 | 3300042636 | Archaea | 1916 |
| 9 | Ga0466704_079689 | 3300042643 | Bacteria | 8704 |
| 10 | Ga0466709_159290 | 3300042648 | Bacteria | 18583 |
| 11 | Ga0466727_250157 | 3300042655 | Bacteria | 1003 |
| 12 | Ga0466711_391486 | 3300042615 | Bacteria | 11141 |
| 13 | Ga0466706_039990 | 3300042599 | Bacteria | 82239 |
| 14 | Ga0466706_163974 | 3300042599 | Bacteria | 8219 |
| 15 | Ga0466713_060620 | 3300042602 | Bacteria | 398690 |
| 16 | Ga0466713_110965 | 3300042602 | Bacteria | 66281 |
| 17 | Ga0466713_123775 | 3300042602 | Bacteria | 23789 |
| 18 | Ga0466714_063465 | 3300042603 | Bacteria | 2454 |
| 19 | Ga0466714_092453 | 3300042603 | Bacteria | 62724 |
| 20 | Ga0466719_070992 | 3300042606 | Bacteria | 21195 |
| 21 | Ga0466705_041408 | 3300042612 | Bacteria | 14416 |
| 22 | Ga0466705_135708 | 3300042612 | Unclassified | 2189 |
| 23 | Ga0466732_298091 | 3300042656 | Unclassified | 2356 |
| 24 | Ga0466733_008901 | 3300042659 | Bacteria | 5865 |
| 25 | Ga0466733_038064 | 3300042659 | Bacteria | 7494 |
| 26 | Ga0466733_040026 | 3300042659 | Bacteria | 8161 |
| 27 | Ga0123353_12211157 | 3300010167 | Bacteria | 665 |
| 28 | Ga0466692_028697 | 3300042591 | Bacteria | 10238 |
| 29 | Ga0466696_142131 | 3300042596 | Bacteria | 3176 |
| 30 | Ga0466696_179297 | 3300042596 | Bacteria | 26500 |
| 31 | Ga0466735_068551 | 3300042624 | Bacteria | 2591 |
| 32 | Ga0466735_163978 | 3300042624 | Bacteria | 2309 |
| 33 | Ga0466703_040840 | 3300042636 | Bacteria | 1319 |
| 34 | Ga0466703_327605 | 3300042636 | Bacteria | 2471 |
| 35 | Ga0466704_481407 | 3300042643 | Bacteria | 6064 |
| 36 | Ga0466727_243362 | 3300042655 | Bacteria | 1765 |
| 37 | Ga0466711_027605 | 3300042615 | Bacteria | 6193 |
| 38 | Ga0466711_141651 | 3300042615 | Bacteria | 4356 |
| 39 | Ga0466715_142524 | 3300042616 | Bacteria | 16757 |
| 40 | Ga0466706_014807 | 3300042599 | Bacteria | 31983 |
| 41 | Ga0466707_043958 | 3300042601 | Bacteria | 9657 |
| 42 | Ga0466707_103336 | 3300042601 | Bacteria | 10146 |
| 43 | Ga0466713_088481 | 3300042602 | Bacteria | 9681 |
| 44 | Ga0466713_094233 | 3300042602 | Bacteria | 2425 |
| 45 | Ga0466714_015760 | 3300042603 | Bacteria | 1255 |
| 46 | Ga0466714_043305 | 3300042603 | Bacteria | 2565 |
| 47 | Ga0466714_099215 | 3300042603 | Bacteria | 6744 |
| 48 | Ga0466714_154291 | 3300042603 | Bacteria | 5359 |
| 49 | Ga0466722_261621 | 3300042609 | Bacteria | 3596 |
| 50 | JGI24696J40584_12832329 | 3300002834 | Archaea | 933 |
| 51 | Ga0068305_10434634 | 3300005083 | Unclassified | 2839 |
| 52 | Ga0466696_082759 | 3300042596 | Bacteria | 10491 |
| 53 | Ga0466735_002135 | 3300042624 | Bacteria | 3781 |
| 54 | Ga0466735_044967 | 3300042624 | Bacteria | 5012 |
| 55 | Ga0466735_049082 | 3300042624 | Bacteria | 1917 |
| 56 | Ga0466735_162434 | 3300042624 | Bacteria | 2731 |
| 57 | Ga0466704_223118 | 3300042643 | Bacteria | 11656 |
| 58 | Ga0466704_354911 | 3300042643 | Bacteria | 15781 |
| 59 | Ga0466708_031680 | 3300042652 | Bacteria | 4054 |
| 60 | Ga0466711_106102 | 3300042615 | Bacteria | 9289 |
| 61 | Ga0466711_158359 | 3300042615 | Unclassified | 3477 |
| 62 | Ga0466728_012105 | 3300042620 | Bacteria | 1436 |
| 63 | Ga0466701_073648 | 3300042598 | Bacteria | 2638 |
| 64 | Ga0466706_232861 | 3300042599 | Bacteria | 10354 |
| 65 | Ga0466707_006625 | 3300042601 | Bacteria | 19816 |
| 66 | Ga0466707_100640 | 3300042601 | Bacteria | 8631 |
| 67 | Ga0466713_059975 | 3300042602 | Bacteria | 22865 |
| 68 | Ga0466714_009789 | 3300042603 | Bacteria | 1334 |
| 69 | Ga0466714_128029 | 3300042603 | Bacteria | 1651 |
| 70 | Ga0466714_156518 | 3300042603 | Bacteria | 2869 |
| 71 | Ga0466722_049005 | 3300042609 | Bacteria | 3174 |
| 72 | Ga0466733_130937 | 3300042659 | Bacteria | 27936 |
| 73 | 2227660729 | 2225789004 | Bacteria | 10501 |
| 74 | IMNBL1DRAFT_c0038470 | 3300000062 | Bacteria | 1644 |
| 75 | JGI24695J34938_10361522 | 3300002450 | Bacteria | 640 |
| 76 | JGI24699J35502_11133749 | 3300002509 | Bacteria | 14709 |
| 77 | Ga0068305_10030449 | 3300005083 | Bacteria | 11001 |
| 78 | Ga0104048_1172909 | 3300007143 | Bacteria | 1276 |
| 79 | Ga0466690_259999 | 3300042590 | Bacteria | 17809 |
| 80 | Ga0466692_151407 | 3300042591 | Bacteria | 4384 |
| 81 | Ga0466729_299564 | 3300042621 | Unclassified | 1113 |
| 82 | Ga0466735_229800 | 3300042624 | Bacteria | 5612 |
| 83 | Ga0466703_225493 | 3300042636 | Bacteria | 10266 |
| 84 | Ga0466710_212082 | 3300042613 | Unclassified | 6312 |
| 85 | Ga0466723_238212 | 3300042618 | Bacteria | 5315 |
| 86 | Ga0466706_049207 | 3300042599 | Bacteria | 2529 |
| 87 | Ga0466706_051152 | 3300042599 | Bacteria | 3563 |
| 88 | Ga0466706_051504 | 3300042599 | Bacteria | 2116 |
| 89 | Ga0466706_085954 | 3300042599 | Bacteria | 15828 |
| 90 | Ga0466706_120308 | 3300042599 | Bacteria | 17593 |
| 91 | Ga0466707_268584 | 3300042601 | Bacteria | 1087 |
| 92 | Ga0466714_061367 | 3300042603 | Bacteria | 2284 |
| 93 | Ga0466705_052705 | 3300042612 | Bacteria | 20164 |
| 94 | Ga0466732_447361 | 3300042656 | Bacteria | 66921 |
| 95 | Ga0466733_084421 | 3300042659 | Bacteria | 1710 |
| 96 | JGI24702J35022_10483939 | 3300002462 | Bacteria | 757 |
| 97 | JGI24702J35022_10636322 | 3300002462 | Bacteria | 661 |
| 98 | Ga0068305_10263788 | 3300005083 | Bacteria | 4561 |
| 99 | Ga0123357_10405874 | 3300009784 | Bacteria | 1234 |
| 100 | Ga0265387_1003455 | 3300024582 | Bacteria | 2175 |
| 101 | Ga0466692_012234 | 3300042591 | Bacteria | 21855 |
| 102 | Ga0466692_202977 | 3300042591 | Bacteria | 25725 |
| 103 | Ga0466691_000432 | 3300042593 | Bacteria | 39181 |
| 104 | Ga0466696_202133 | 3300042596 | Bacteria | 4570 |
| 105 | Ga0466735_018809 | 3300042624 | Bacteria | 3340 |
| 106 | Ga0466735_101028 | 3300042624 | Bacteria | 1107 |
| 107 | Ga0466724_43113 | 3300042649 | Bacteria | 2979 |
| 108 | Ga0466715_056997 | 3300042616 | Bacteria | 14431 |
| 109 | Ga0466715_120738 | 3300042616 | Bacteria | 24996 |
| 110 | Ga0466728_282666 | 3300042620 | Bacteria | 52404 |
| 111 | Ga0466706_056584 | 3300042599 | Unclassified | 12095 |
| 112 | Ga0466706_078679 | 3300042599 | Bacteria | 8059 |
| 113 | Ga0466706_163720 | 3300042599 | Bacteria | 10112 |
| 114 | Ga0466706_241309 | 3300042599 | Bacteria | 1150 |
| 115 | Ga0466713_064134 | 3300042602 | Bacteria | 51452 |
| 116 | Ga0466722_227250 | 3300042609 | Bacteria | 1397 |
| 117 | Ga0466705_305301 | 3300042612 | Bacteria | 1548 |
| 118 | Ga0466733_136084 | 3300042659 | Bacteria | 48551 |
| 119 | JGI24702J35022_10000192 | 3300002462 | Bacteria | 32902 |
| 120 | Ga0123357_10152137 | 3300009784 | Bacteria | 2803 |
| 121 | Ga0123356_10492705 | 3300010049 | Bacteria | 1380 |
| 122 | Ga0123356_10707446 | 3300010049 | Bacteria | 1177 |
| 123 | Ga0466656_131898 | 3300042550 | Bacteria | 1202 |
| 124 | Ga0466691_058842 | 3300042593 | Bacteria | 20577 |
| 125 | Ga0466696_279917 | 3300042596 | Bacteria | 5356 |
| 126 | Ga0466704_292184 | 3300042643 | Bacteria | 18609 |
| 127 | Ga0466709_094616 | 3300042648 | Bacteria | 182057 |
| 128 | Ga0466709_363785 | 3300042648 | Bacteria | 41688 |
| 129 | Ga0466727_282457 | 3300042655 | Bacteria | 2201 |
| 130 | Ga0466710_141431 | 3300042613 | Unclassified | 19401 |
| 131 | Ga0466715_287610 | 3300042616 | Bacteria | 14683 |
| 132 | Ga0466723_146492 | 3300042618 | Bacteria | 10019 |
| 133 | Ga0466706_251839 | 3300042599 | Bacteria | 10321 |
| 134 | Ga0466713_054718 | 3300042602 | Bacteria | 26012 |
| 135 | Ga0466714_026394 | 3300042603 | Bacteria | 5099 |
| 136 | Ga0466714_122616 | 3300042603 | Bacteria | 3649 |
| 137 | Ga0466714_143376 | 3300042603 | Bacteria | 3978 |
| 138 | Ga0466714_169829 | 3300042603 | Bacteria | 1553 |
| 139 | Ga0466733_003122 | 3300042659 | Bacteria | 3841 |
| 140 | Ga0466733_176543 | 3300042659 | Bacteria | 2350 |
| 141 | IMNBL1DRAFT_c0022807 | 3300000062 | Bacteria | 2468 |
| 142 | JGI24702J35022_10033806 | 3300002462 | Bacteria | 2735 |
| 143 | Ga0068305_10908044 | 3300005083 | Bacteria | 1071 |
| 144 | Ga0265387_1001993 | 3300024582 | Bacteria | 2912 |
| 145 | Ga0466657_296737 | 3300042582 | Bacteria | 1661 |
| 146 | Ga0466690_188044 | 3300042590 | Bacteria | 53126 |
| 147 | Ga0466696_212871 | 3300042596 | Bacteria | 2844 |
| 148 | Ga0466735_039000 | 3300042624 | Bacteria | 1916 |
| 149 | Ga0466708_024600 | 3300042652 | Unclassified | 3867 |
| 150 | Ga0466708_130167 | 3300042652 | Bacteria | 53436 |
| 151 | Ga0466705_402854 | 3300042612 | Bacteria | 3978 |
| 152 | Ga0466711_220778 | 3300042615 | Unclassified | 3573 |
| 153 | Ga0466711_500392 | 3300042615 | Bacteria | 1645 |
| 154 | Ga0466706_057326 | 3300042599 | Bacteria | 4366 |
| 155 | Ga0466706_063485 | 3300042599 | Bacteria | 4314 |
| 156 | Ga0466706_134861 | 3300042599 | Bacteria | 19873 |
| 157 | Ga0466706_175135 | 3300042599 | Bacteria | 1981 |
| 158 | Ga0466714_100646 | 3300042603 | Bacteria | 1373 |
| 159 | Ga0466714_146062 | 3300042603 | Bacteria | 3408 |
| 160 | Ga0466716_034067 | 3300042605 | Bacteria | 12537 |
| 161 | Ga0466716_330436 | 3300042605 | Bacteria | 29540 |
| 162 | Ga0466697_172309 | 3300042611 | Bacteria | 15622 |
| 163 | Ga0466733_026317 | 3300042659 | Bacteria | 3335 |
| 164 | Ga0466733_114737 | 3300042659 | Bacteria | 3094 |
| 165 | Ga0466733_118390 | 3300042659 | Bacteria | 16819 |
| 166 | Ga0466733_147923 | 3300042659 | Bacteria | 1976 |
| 167 | Ga0466733_183170 | 3300042659 | Bacteria | 1349 |
| 168 | 2227303006 | 2225789004 | Bacteria | 29397 |
| 169 | JGI24702J35022_10011993 | 3300002462 | Bacteria | 4826 |
| 170 | JGI24705J35276_12195860 | 3300002504 | Bacteria | 1531 |
| 171 | Ga0123357_10148855 | 3300009784 | Bacteria | 2849 |
| 172 | Ga0265387_1065059 | 3300024582 | Bacteria | 689 |
| 173 | Ga0466657_298022 | 3300042582 | Bacteria | 6364 |
| 174 | Ga0466696_367343 | 3300042596 | Bacteria | 6569 |
| 175 | Ga0466725_398636 | 3300042654 | Bacteria | 2036 |
| 176 | Ga0466727_335522 | 3300042655 | Bacteria | 3110 |
| 177 | Ga0466712_007983 | 3300042614 | Bacteria | 3026 |
| 178 | Ga0466706_180987 | 3300042599 | Bacteria | 7199 |
| 179 | Ga0466707_288877 | 3300042601 | Bacteria | 1115 |
| 180 | Ga0466713_045441 | 3300042602 | Unclassified | 3275 |
| 181 | Ga0466714_070369 | 3300042603 | Bacteria | 2316 |
| 182 | Ga0466714_084499 | 3300042603 | Bacteria | 1377 |
| 183 | Ga0466714_092098 | 3300042603 | Bacteria | 5327 |
| 184 | Ga0466714_111561 | 3300042603 | Bacteria | 28647 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01195 | Pept_tRNA_hydro | Peptidyl-tRNA hydrolase | 50 | 230 | 0.96 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01195 | GO:0004045 | aminoacyl-tRNA hydrolase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.