Protein Family IF04405

Metagenome Isolate
150 Members
42 Samples
135 Scaffolds
248.29 Avg Length

🧬 Representative Sequence

ID
3300042582|Ga0466657_134257|Ga0466657_134257_36_797
Length
253 aa
Sequence
MNKYQRTAKYDEKWIEENWMGPHPLQLLEELCGNMKLSPGMKVLDMGCGKGITSVFLAKEFGVTVFANDLWIDPTENLKRFEEAGVSEKVFPIQAEAHALPYAKCFFDAVISIDSYHYYGADEMYFPCIFSKLVKPGGQLGIVIPGLVQEFKNGYPENMKSFWMKEETEGELFSFHSASWWRHLWEKTGIADITSCYNIPDPKAIWYSWAHWANKNMKAIFNIESDDVEFLEADTENQIALIAMTAIKKLHEK

📊 Sample Types

Isolate 10.0%
Metagenome 90.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 50.0%
Unclassified 37.5%
Passalidae 5.0%
Kalotermitidae 5.0%
Hodotermitidae 2.5%

🌳 Taxonomy

Archaea 33
Bacteria 105
Eukaryota 0
Viruses 0
Unclassified 12

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820420508 Unclassified Firmicutes Lab288P3bin68 Isolate Unclassified
2 2820593525 Unclassified Firmicutes Emb289P1bin7 Isolate Unclassified
3 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
4 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
5 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
6 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
7 2820541116 Unclassified Firmicutes Lab288P1bin109 Isolate Unclassified
8 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
9 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
10 2820327087 Unclassified Firmicutes Nt197P3bin79 Isolate Unclassified
11 2820344559 Unclassified Firmicutes Nt197P3bin63 Isolate Unclassified
12 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
13 2820369699 Unclassified Firmicutes Nt197P3bin103 Isolate Unclassified
14 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
15 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
16 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
17 2820854745 Unclassified Actinobacteria Lab288P3bin234 Isolate Unclassified
18 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
19 2820495292 Unclassified Firmicutes Lab288P1bin59 Isolate Unclassified
20 2791354849 Unclassified Chloroflexi Lab288P3bin29 Isolate Unclassified
21 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
22 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
23 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
24 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
25 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
26 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
27 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
28 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
29 2820005795 Unclassified Synergistetes Nt197P3bin106 Isolate Unclassified
30 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
31 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
32 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
33 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
34 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
35 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
36 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
37 2820350530 Unclassified Firmicutes Nt197P3bin37 Isolate Unclassified
38 2820823448 Unclassified Actinobacteria Nt197P3bin113 Isolate Unclassified
39 2820916033 Unclassified Actinobacteria Emb289P3bin63 Isolate Unclassified
40 2820414148 Unclassified Firmicutes Lab288P3bin93 Isolate Unclassified
41 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
42 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466717_042135 3300042604 Bacteria 3091
2 Ga0466717_254127 3300042604 Archaea 1485
3 Ga0466721_133776 3300042608 Archaea 1157
4 JGI24705J35276_12128266 3300002504 Bacteria 1095
5 Ga0123356_10003419 3300010049 Bacteria 16635
6 Ga0123356_10030169 3300010049 Bacteria 5075
7 Ga0123356_10057556 3300010049 Bacteria 3624
8 Ga0123356_10211558 3300010049 Bacteria 1988
9 Ga0123356_10495669 3300010049 Bacteria 1377
10 Ga0123356_10552680 3300010049 Archaea 1312
11 Ga0123356_10729469 3300010049 Bacteria 1161
12 Ga0123353_10016318 3300010167 Bacteria 10850
13 Ga0123353_10131412 3300010167 Bacteria 4016
14 Ga0123353_10211493 3300010167 Unclassified 3042
15 Ga0123353_10517028 3300010167 Bacteria 1733
16 Ga0123353_10606890 3300010167 Bacteria 1562
17 Ga0466731_226055 3300042622 Bacteria 4328
18 Ga0466731_420874 3300042622 Archaea 1036
19 Ga0466725_219142 3300042654 Bacteria 2569
20 Ga0264413_156676 3300024493 Bacteria 2733
21 Ga0466691_203894 3300042593 Bacteria 22141
22 Ga0466695_316961 3300042595 Bacteria 1769
23 Ga0466700_060101 3300042600 Bacteria 1037
24 Ga0072941_1339920 3300005201 Bacteria 2755
25 Ga0123356_10047208 3300010049 Bacteria 4006
26 Ga0123356_10215375 3300010049 Archaea 1973
27 Ga0123356_10301990 3300010049 Bacteria 1706
28 Ga0123353_10007744 3300010167 Bacteria 14572
29 Ga0123353_10109615 3300010167 Bacteria 4447
30 Ga0123353_10265326 3300010167 Bacteria 2649
31 Ga0123353_10492767 3300010167 Bacteria 1789
32 Ga0123353_10528497 3300010167 Unclassified 1709
33 Ga0123353_10559395 3300010167 Archaea 1647
34 Ga0123353_10621979 3300010167 Archaea 1537
35 Ga0123353_11335905 3300010167 Archaea 927
36 Ga0123354_10299491 3300010882 Archaea 1524
37 Ga0466725_009994 3300042654 Bacteria 1881
38 Ga0466693_145287 3300042592 Bacteria 1046
39 Ga0466694_046606 3300042594 Bacteria 6434
40 Ga0466694_327016 3300042594 Archaea 1143
41 Ga0466706_022120 3300042599 Bacteria 3130
42 2227164442 2225789004 Unclassified 1543
43 JGI24696J40584_12873197 3300002834 Bacteria 1054
44 Ga0466718_159912 3300042617 Archaea 1035
45 Ga0123356_10048097 3300010049 Bacteria 3969
46 Ga0123356_10079305 3300010049 Bacteria 3101
47 Ga0123353_10032486 3300010167 Bacteria 8105
48 Ga0123353_10050232 3300010167 Bacteria 6647
49 Ga0466725_269158 3300042654 Bacteria 1110
50 Ga0466717_014202 3300042604 Bacteria 20016
51 Ga0466717_164885 3300042604 Archaea 1086
52 Ga0466717_222255 3300042604 Bacteria 1689
53 IMNBL1DRAFT_c0001733 3300000062 Archaea 16013
54 Ga0123356_10009127 3300010049 Bacteria 9810
55 Ga0123356_10114381 3300010049 Bacteria 2612
56 Ga0123356_10117338 3300010049 Bacteria 2582
57 Ga0123356_10121939 3300010049 Bacteria 2537
58 Ga0123356_10660319 3300010049 Archaea 1213
59 Ga0123356_10877021 3300010049 Archaea 1068
60 Ga0123353_10009465 3300010167 Bacteria 13462
61 Ga0123353_10092453 3300010167 Unclassified 4874
62 Ga0123353_10175720 3300010167 Bacteria 3395
63 Ga0415639_015056 3300038395 Unclassified 4692
64 Ga0415639_017281 3300038395 Bacteria 7506
65 Ga0466694_104519 3300042594 Bacteria 22007
66 Ga0466714_042188 3300042603 Bacteria 3001
67 AustNasuHG_c1013532 3300000089 Archaea 2795
68 Ga0466718_001435 3300042617 Bacteria 1220
69 Ga0123355_10000853 3300009826 Bacteria 42039
70 Ga0123355_10392100 3300009826 Bacteria 1799
71 Ga0123355_10611187 3300009826 Archaea 1289
72 Ga0123356_10006990 3300010049 Bacteria 11329
73 Ga0123356_10119015 3300010049 Bacteria 2565
74 Ga0123356_10439686 3300010049 Bacteria 1450
75 Ga0123356_10628920 3300010049 Archaea 1239
76 Ga0123356_11010958 3300010049 Bacteria 1001
77 Ga0123353_10036909 3300010167 Bacteria 7661
78 Ga0123353_10250340 3300010167 Bacteria 2744
79 Ga0123353_10428094 3300010167 Unclassified 1958
80 Ga0123353_10640851 3300010167 Bacteria 1507
81 Ga0123353_11547068 3300010167 Archaea 841
82 Ga0123354_10268352 3300010882 Archaea 1686
83 Ga0123354_10481646 3300010882 Unclassified 981
84 Ga0466657_134257 3300042582 Bacteria 1126
85 Ga0466717_199299 3300042604 Bacteria 2831
86 2227395288 2225789004 Archaea 1080
87 JGI24705J35276_12217878 3300002504 Bacteria 2116
88 Ga0466718_127896 3300042617 Bacteria 2220
89 Ga0466723_296987 3300042618 Bacteria 9088
90 Ga0123356_10022156 3300010049 Bacteria 6000
91 Ga0123356_10027687 3300010049 Bacteria 5310
92 Ga0123356_10038559 3300010049 Bacteria 4453
93 Ga0123356_10261195 3300010049 Bacteria 1816
94 Ga0123356_10844354 3300010049 Archaea 1087
95 Ga0123353_10137081 3300010167 Bacteria 3924
96 Ga0123353_10242663 3300010167 Bacteria 2798
97 Ga0123353_10626441 3300010167 Archaea 1530
98 Ga0123353_10749442 3300010167 Bacteria 1360
99 Ga0123353_10822096 3300010167 Archaea 1279
100 Ga0123353_10888771 3300010167 Archaea 1215
101 Ga0123353_11091476 3300010167 Archaea 1061
102 Ga0123353_11688375 3300010167 Archaea 794
103 Ga0415639_034861 3300038395 Bacteria 4371
104 Ga0466694_356035 3300042594 Archaea 1651
105 Ga0466695_296161 3300042595 Bacteria 4303
106 Ga0466721_301372 3300042608 Archaea 1082
107 Ga0466718_009150 3300042617 Bacteria 2395
108 Ga0466718_115112 3300042617 Bacteria 1087
109 Ga0123355_10158445 3300009826 Bacteria 3418
110 Ga0123356_10321966 3300010049 Bacteria 1659
111 Ga0123356_10409098 3300010049 Bacteria 1496
112 Ga0123356_10577802 3300010049 Bacteria 1287
113 Ga0123353_10000117 3300010167 Bacteria 93955
114 Ga0123353_10016707 3300010167 Bacteria 10743
115 Ga0123353_10498391 3300010167 Unclassified 1775
116 Ga0466731_102519 3300042622 Bacteria 3667
117 Ga0466725_372699 3300042654 Bacteria 1017
118 Ga0415639_035451 3300038395 Unclassified 3469
119 Ga0466656_248617 3300042550 Bacteria 1272
120 Ga0466693_216649 3300042592 Archaea 2086
121 Ga0466717_282397 3300042604 Archaea 1013
122 JGI24705J35276_12065047 3300002504 Bacteria 943
123 JGI24705J35276_12144093 3300002504 Archaea 1153
124 JGI24705J35276_12203435 3300002504 Unclassified 1655
125 Ga0466718_114827 3300042617 Bacteria 3347
126 Ga0123355_10010812 3300009826 Bacteria 14030
127 Ga0123356_10011254 3300010049 Bacteria 8731
128 Ga0123356_10112419 3300010049 Bacteria 2633
129 Ga0123356_10242343 3300010049 Bacteria 1875
130 Ga0123353_10001146 3300010167 Bacteria 32345
131 Ga0123353_10005253 3300010167 Bacteria 16929
132 Ga0123353_10037157 3300010167 Bacteria 7638
133 Ga0123353_10056474 3300010167 Unclassified 6284
134 Ga0123353_10528730 3300010167 Archaea 1708
135 Ga0123353_10554348 3300010167 Unclassified 1657

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13649 Methyltransf_25 Methyltransferase domain 43 138 0.87
PF08241 Methyltransf_11 Methyltransferase domain 44 140 0.81
PF02353 CMAS Mycolic acid cyclopropane synthetase 29 140 0.79
PF13489 Methyltransf_23 Methyltransferase domain 37 191 0.73
PF13847 Methyltransf_31 Methyltransferase domain 38 152 0.73

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF08241 GO:0008757 S-adenosylmethionine-dependent methyltransferase activity MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.