Protein Family IF04399
Metagenome
Isolate
250
Members
130
Samples
193
Scaffolds
245.06
Avg Length
Representative Sequence
- ID
- 3300042582|Ga0466657_111763|Ga0466657_111763_148_1020
- Length
- 290 aa
- Sequence
- MDNYNPLCALREFFVSSVVNLYHKGHGGFTKGTEINKLTTMTIKVNLQDRVAIVTGGTRGIGLGICEALAECGAKVACIGTNPEKMKTALEAIKKHGGEAEGYICNVANTEAAEKTVEDVLAKFGKVDILVNCAGITADVPLGAMKDEQWDDVIAVNLRGPFLFTRACTKPMRRAKSGRIINITSISGLIGNKGQANYSASKAGLIGFTRTASKELAGKNITVNAIAPGFVETDMTAVLPEVYKTEIKNRIPLARFGRSEDIANAVLYFASDEASFVTGQTLTIDGGMIM
Sample Types
Isolate
22.8%
Metagenome
77.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
30.4%
Unclassified
19.2%
Kalotermitidae
11.2%
Coreidae
10.4%
Drosophilidae
4.8%
Tenebrionidae
4.0%
Elmidae
3.2%
Termopsidae
3.2%
Formicidae
3.2%
Rhinotermitidae
1.6%
Armadillidiidae
1.6%
Scarabaeidae
1.6%
Blattidae
1.6%
Hodotermitidae
0.8%
Penaeidae
0.8%
Ixodidae
0.8%
Berytidae
0.8%
Tephritidae
0.8%
Taxonomy
Archaea
0
Bacteria
228
Eukaryota
0
Viruses
0
Unclassified
22
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 2 | 2900354037 | Nocardia macrotermitis RB20 | Isolate | Termitidae |
| 3 | 2820205024 | Unclassified Planctomycetes Cu122P4bin3 | Isolate | Unclassified |
| 4 | 2820306284 | Unclassified Firmicutes Th196P1bin11 | Isolate | Unclassified |
| 5 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 6 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 7 | 3300005309 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 1 gut | Metagenome | Drosophilidae |
| 8 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 12 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 13 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 14 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 15 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 16 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 17 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 18 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 19 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 20 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 21 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 22 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 23 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 24 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 25 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 26 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 27 | 2900368070 | Nocardia aurantia RB56 | Isolate | Termitidae |
| 28 | 2524614573 | Marinospirillum minutulum DSM 6287 | Isolate | Unclassified |
| 29 | 2820075487 | Unclassified Proteobacteria Nt197P3bin122 | Isolate | Unclassified |
| 30 | 2820178484 | Unclassified Planctomycetes Th196P3bin110 | Isolate | Unclassified |
| 31 | 3006461590 | Streptomyces sp. RB5 | Isolate | Termitidae |
| 32 | 3006667155 | Streptomyces sp. SID9727 | Isolate | |
| 33 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 34 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 35 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 36 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 37 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 38 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 39 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 40 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 41 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 42 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 43 | 2820857933 | Unclassified Actinobacteria Lab288P3bin173 | Isolate | Unclassified |
| 44 | 2883683260 | Protaetiibacter larvae KACC 19322 | Isolate | Scarabaeidae |
| 45 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 46 | 2820180635 | Unclassified Planctomycetes Lab288P3bin24 | Isolate | Unclassified |
| 47 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 48 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 49 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 50 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 51 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 52 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 53 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 54 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 55 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 56 | 2590828841 | Oscillospiraceae bacterium Ne3 | Isolate | Termitidae |
| 57 | 2820298281 | Unclassified Firmicutes Th196P1bin9 | Isolate | Unclassified |
| 58 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 59 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 60 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 61 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 62 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 63 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 64 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 65 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 66 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 67 | 8073544309 | Actinomadura sp. RB99 | Isolate | Termitidae |
| 68 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 69 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 70 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 71 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 72 | 2834951433 | Brochothrix thermosphacta CD 337 | Isolate | Unclassified |
| 73 | 2862784999 | Streptomyces sp. M41 | Isolate | Unclassified |
| 74 | 2864976888 | Novosphingobium chloroacetimidivorans S00245 | Isolate | Elmidae |
| 75 | 2931425734 | Nocardioides sp. J2M5 | Isolate | |
| 76 | 2718217924 | Pseudonocardia sp. HH130630-07 | Isolate | Formicidae |
| 77 | 2820185449 | Unclassified Planctomycetes Lab288P3bin146 | Isolate | Unclassified |
| 78 | 2820303403 | Unclassified Firmicutes Th196P1bin2 | Isolate | Unclassified |
| 79 | 2599185121 | Rickettsiales bacterium Ac37b | Isolate | Ixodidae |
| 80 | 2758568796 | Unclassified Deltaproteobacteria Th196P3_bin21 | Isolate | Unclassified |
| 81 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 82 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 83 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 84 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 85 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 86 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 87 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 88 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 89 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 90 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 91 | 2820171952 | Unclassified Planctomycetes Th196P3bin88 | Isolate | Unclassified |
| 92 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 93 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 94 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 95 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 96 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 97 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 98 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 99 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 100 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 101 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 102 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 103 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 104 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 105 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 106 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 107 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 108 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 109 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 110 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 111 | 8012935351 | Brevibacterium epidermidis UD i117 | Isolate | Unclassified |
| 112 | 8118075156 | Actinosynnema pretiosum DSM 44131 | Isolate | Unclassified |
| 113 | 2820882373 | Unclassified Actinobacteria Lab288P1bin45 | Isolate | Unclassified |
| 114 | 2836973655 | Gryllotalpicola protaetiae 2DFW10M-5 | Isolate | Scarabaeidae |
| 115 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 116 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 117 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 118 | 2820580397 | Unclassified Firmicutes Emb289P3bin133 | Isolate | Unclassified |
| 119 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 120 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 121 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 122 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 123 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 124 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 125 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 126 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 127 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 128 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 129 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 130 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_252013 | 3300042611 | Bacteria | 1171 |
| 2 | Ga0466705_031509 | 3300042612 | Unclassified | 2811 |
| 3 | Ga0466705_202645 | 3300042612 | Bacteria | 3041 |
| 4 | Ga0466705_373275 | 3300042612 | Bacteria | 62368 |
| 5 | JGI24703J35330_11747266 | 3300002501 | Bacteria | 6422 |
| 6 | Ga0072941_1185889 | 3300005201 | Bacteria | 8591 |
| 7 | Ga0104050_1026236 | 3300007153 | Bacteria | 5185 |
| 8 | Ga0466735_091036 | 3300042624 | Bacteria | 1279 |
| 9 | Ga0466730_098762 | 3300042625 | Bacteria | 4884 |
| 10 | Ga0466703_335270 | 3300042636 | Bacteria | 2844 |
| 11 | Ga0466703_400054 | 3300042636 | Bacteria | 25075 |
| 12 | Ga0466725_334026 | 3300042654 | Bacteria | 20181 |
| 13 | Ga0466715_256397 | 3300042616 | Bacteria | 48192 |
| 14 | Ga0466726_488221 | 3300042619 | Bacteria | 11893 |
| 15 | Ga0466728_030864 | 3300042620 | Bacteria | 4372 |
| 16 | Ga0466657_115955 | 3300042582 | Bacteria | 2422 |
| 17 | Ga0466692_027880 | 3300042591 | Bacteria | 5408 |
| 18 | Ga0466691_147010 | 3300042593 | Bacteria | 12569 |
| 19 | Ga0466696_142742 | 3300042596 | Bacteria | 5137 |
| 20 | Ga0466696_240032 | 3300042596 | Unclassified | 1256 |
| 21 | Ga0466696_308680 | 3300042596 | Bacteria | 10572 |
| 22 | Ga0466696_468154 | 3300042596 | Bacteria | 7557 |
| 23 | Ga0466701_007770 | 3300042598 | Bacteria | 3545 |
| 24 | Ga0123356_10010402 | 3300010049 | Bacteria | 9131 |
| 25 | Ga0123353_10003648 | 3300010167 | Bacteria | 19519 |
| 26 | Ga0123353_10009282 | 3300010167 | Bacteria | 13547 |
| 27 | Ga0123353_11048605 | 3300010167 | Bacteria | 1089 |
| 28 | Ga0466707_004272 | 3300042601 | Bacteria | 5162 |
| 29 | Ga0466707_140572 | 3300042601 | Bacteria | 11150 |
| 30 | Ga0466714_074721 | 3300042603 | Bacteria | 12135 |
| 31 | Ga0466733_093530 | 3300042659 | Bacteria | 1042 |
| 32 | Ga0562376_0347 | 3300056857 | Bacteria | 89747 |
| 33 | JGI24695J34938_10014075 | 3300002450 | Bacteria | 4166 |
| 34 | Ga0466731_043138 | 3300042622 | Bacteria | 1342 |
| 35 | Ga0466704_341138 | 3300042643 | Unclassified | 12980 |
| 36 | Ga0466725_194867 | 3300042654 | Bacteria | 1154 |
| 37 | Ga0466727_326802 | 3300042655 | Bacteria | 2934 |
| 38 | Ga0466712_077857 | 3300042614 | Bacteria | 2036 |
| 39 | Ga0466711_008920 | 3300042615 | Bacteria | 31149 |
| 40 | Ga0466715_028816 | 3300042616 | Bacteria | 22566 |
| 41 | Ga0466715_328267 | 3300042616 | Bacteria | 30142 |
| 42 | Ga0466715_411922 | 3300042616 | Bacteria | 42002 |
| 43 | Ga0466715_430251 | 3300042616 | Bacteria | 2977 |
| 44 | Ga0466718_009595 | 3300042617 | Bacteria | 13596 |
| 45 | Ga0466723_002617 | 3300042618 | Bacteria | 5899 |
| 46 | Ga0466729_056090 | 3300042621 | Bacteria | 2243 |
| 47 | Ga0466656_203217 | 3300042550 | Unclassified | 1299 |
| 48 | Ga0466690_277573 | 3300042590 | Bacteria | 3461 |
| 49 | Ga0466695_268753 | 3300042595 | Unclassified | 1076 |
| 50 | Ga0466696_016976 | 3300042596 | Bacteria | 5434 |
| 51 | Ga0123356_10204236 | 3300010049 | Bacteria | 2018 |
| 52 | Ga0123353_10041135 | 3300010167 | Bacteria | 7297 |
| 53 | Ga0466717_284212 | 3300042604 | Bacteria | 1899 |
| 54 | Ga0466733_108458 | 3300042659 | Bacteria | 2476 |
| 55 | Ga0562378_0322 | 3300056814 | Bacteria | 97514 |
| 56 | Ga0562375_0005 | 3300056856 | Bacteria | 2472444 |
| 57 | Ga0562375_0008 | 3300056856 | Bacteria | 1786936 |
| 58 | Ga0074306_1120551 | 3300005309 | Bacteria | 1152 |
| 59 | Ga0104045_1000813 | 3300007085 | Bacteria | 2168 |
| 60 | Ga0104019_1002369 | 3300007150 | Unclassified | 13975 |
| 61 | Ga0466704_195474 | 3300042643 | Bacteria | 3117 |
| 62 | Ga0466727_296452 | 3300042655 | Bacteria | 6947 |
| 63 | Ga0466715_217733 | 3300042616 | Bacteria | 2666 |
| 64 | Ga0466691_007402 | 3300042593 | Bacteria | 4086 |
| 65 | Ga0123356_10031496 | 3300010049 | Unclassified | 4962 |
| 66 | Ga0466707_410899 | 3300042601 | Bacteria | 7888 |
| 67 | Ga0466713_136097 | 3300042602 | Unclassified | 3842 |
| 68 | Ga0466719_295792 | 3300042606 | Bacteria | 1463 |
| 69 | JGI24702J35022_10035770 | 3300002462 | Bacteria | 2655 |
| 70 | Ga0068305_10698746 | 3300005083 | Bacteria | 2123 |
| 71 | Ga0104048_1004040 | 3300007143 | Bacteria | 33948 |
| 72 | Ga0466729_240241 | 3300042621 | Bacteria | 5021 |
| 73 | Ga0466729_318198 | 3300042621 | Bacteria | 4910 |
| 74 | Ga0466730_103185 | 3300042625 | Bacteria | 215676 |
| 75 | Ga0466702_206692 | 3300042635 | Bacteria | 1528 |
| 76 | Ga0466703_243975 | 3300042636 | Bacteria | 7167 |
| 77 | Ga0466703_368666 | 3300042636 | Bacteria | 3201 |
| 78 | Ga0466704_163391 | 3300042643 | Bacteria | 191559 |
| 79 | Ga0466704_200065 | 3300042643 | Unclassified | 1342 |
| 80 | Ga0466708_319754 | 3300042652 | Bacteria | 5752 |
| 81 | Ga0466710_105959 | 3300042613 | Bacteria | 1138 |
| 82 | Ga0466710_116295 | 3300042613 | Unclassified | 4013 |
| 83 | Ga0466712_228864 | 3300042614 | Bacteria | 1197 |
| 84 | Ga0466656_085798 | 3300042550 | Bacteria | 1749 |
| 85 | Ga0466690_189331 | 3300042590 | Bacteria | 1452 |
| 86 | Ga0466696_076357 | 3300042596 | Bacteria | 165705 |
| 87 | Ga0466699_279466 | 3300042597 | Bacteria | 4867 |
| 88 | Ga0123355_10934417 | 3300009826 | Bacteria | 935 |
| 89 | Ga0123356_10033156 | 3300010049 | Unclassified | 4830 |
| 90 | Ga0123353_10033185 | 3300010167 | Bacteria | 8032 |
| 91 | Ga0123353_10131957 | 3300010167 | Bacteria | 4008 |
| 92 | Ga0160466_100058 | 3300012809 | Bacteria | 135194 |
| 93 | Ga0466701_102031 | 3300042598 | Bacteria | 201577 |
| 94 | Ga0466700_211296 | 3300042600 | Bacteria | 2094 |
| 95 | Ga0466717_085319 | 3300042604 | Unclassified | 1732 |
| 96 | Ga0466716_174255 | 3300042605 | Bacteria | 80141 |
| 97 | Ga0466719_253546 | 3300042606 | Bacteria | 1385 |
| 98 | Ga0466697_237856 | 3300042611 | Bacteria | 1644 |
| 99 | Ga0466732_007696 | 3300042656 | Bacteria | 4977 |
| 100 | Ga0562378_0468 | 3300056814 | Bacteria | 68204 |
| 101 | JGI24695J34938_10143656 | 3300002450 | Bacteria | 975 |
| 102 | JGI24702J35022_10003201 | 3300002462 | Bacteria | 9902 |
| 103 | JGI24702J35022_10034488 | 3300002462 | Bacteria | 2707 |
| 104 | JGI24700J35501_10929917 | 3300002508 | Bacteria | 10614 |
| 105 | JGI24700J35501_10930878 | 3300002508 | Bacteria | 32238 |
| 106 | CVPL005L_10000930 | 3300002938 | Bacteria | 45582 |
| 107 | Ga0466704_067703 | 3300042643 | Unclassified | 4041 |
| 108 | Ga0466704_115779 | 3300042643 | Bacteria | 2632 |
| 109 | Ga0466724_28891 | 3300042649 | Bacteria | 455231 |
| 110 | Ga0466708_096464 | 3300042652 | Bacteria | 1783 |
| 111 | Ga0466712_163295 | 3300042614 | Bacteria | 1087 |
| 112 | Ga0466712_275107 | 3300042614 | Bacteria | 2393 |
| 113 | Ga0466711_192751 | 3300042615 | Bacteria | 10174 |
| 114 | Ga0466726_376847 | 3300042619 | Bacteria | 3123 |
| 115 | Ga0466690_159023 | 3300042590 | Bacteria | 5560 |
| 116 | Ga0466690_190178 | 3300042590 | Bacteria | 82901 |
| 117 | Ga0466693_316369 | 3300042592 | Bacteria | 138024 |
| 118 | Ga0466691_004003 | 3300042593 | Bacteria | 81601 |
| 119 | Ga0466691_006190 | 3300042593 | Bacteria | 85330 |
| 120 | Ga0466691_110466 | 3300042593 | Bacteria | 3313 |
| 121 | Ga0466694_025313 | 3300042594 | Bacteria | 1063 |
| 122 | Ga0123356_11097360 | 3300010049 | Bacteria | 964 |
| 123 | Ga0123353_10069002 | 3300010167 | Bacteria | 5678 |
| 124 | Ga0123353_10224138 | 3300010167 | Bacteria | 2937 |
| 125 | Ga0123354_10273801 | 3300010882 | Bacteria | 1655 |
| 126 | Ga0466706_004420 | 3300042599 | Bacteria | 1426 |
| 127 | Ga0466700_330278 | 3300042600 | Bacteria | 2421 |
| 128 | Ga0466700_388638 | 3300042600 | Bacteria | 1435 |
| 129 | Ga0466707_103508 | 3300042601 | Bacteria | 1431 |
| 130 | Ga0466707_170863 | 3300042601 | Bacteria | 4363 |
| 131 | Ga0466707_300048 | 3300042601 | Bacteria | 78479 |
| 132 | Ga0466719_152876 | 3300042606 | Unclassified | 9911 |
| 133 | Ga0104048_1022419 | 3300007143 | Bacteria | 4069 |
| 134 | Ga0466734_030250 | 3300042623 | Bacteria | 10707 |
| 135 | Ga0466730_030722 | 3300042625 | Bacteria | 1135247 |
| 136 | Ga0466702_461976 | 3300042635 | Bacteria | 1058 |
| 137 | Ga0466724_39980 | 3300042649 | Bacteria | 8266 |
| 138 | Ga0466710_204267 | 3300042613 | Bacteria | 1672 |
| 139 | Ga0466715_253178 | 3300042616 | Bacteria | 66046 |
| 140 | Ga0160455_100001 | 3300012837 | Bacteria | 1265300 |
| 141 | Ga0160457_1000855 | 3300012858 | Bacteria | 10544 |
| 142 | Ga0466690_342359 | 3300042590 | Bacteria | 3940 |
| 143 | Ga0466696_151464 | 3300042596 | Bacteria | 1848 |
| 144 | Ga0123355_10002125 | 3300009826 | Bacteria | 27988 |
| 145 | Ga0123356_10025998 | 3300010049 | Unclassified | 5503 |
| 146 | Ga0123356_10193912 | 3300010049 | Unclassified | 2065 |
| 147 | Ga0466701_021238 | 3300042598 | Bacteria | 58804 |
| 148 | Ga0466707_159669 | 3300042601 | Bacteria | 505639 |
| 149 | Ga0466707_396440 | 3300042601 | Bacteria | 13525 |
| 150 | Ga0466717_093847 | 3300042604 | Bacteria | 11973 |
| 151 | Ga0466716_036380 | 3300042605 | Bacteria | 5667 |
| 152 | Ga0466716_120573 | 3300042605 | Bacteria | 8630 |
| 153 | Ga0466719_253282 | 3300042606 | Bacteria | 3285 |
| 154 | JGI24698J34947_10030981 | 3300002449 | Bacteria | 2818 |
| 155 | Ga0068302_10667147 | 3300005071 | Bacteria | 1633 |
| 156 | Ga0466735_049014 | 3300042624 | Bacteria | 66415 |
| 157 | Ga0466703_082242 | 3300042636 | Bacteria | 5000 |
| 158 | Ga0466703_096513 | 3300042636 | Bacteria | 1505 |
| 159 | Ga0466703_101952 | 3300042636 | Bacteria | 3251 |
| 160 | Ga0466709_373654 | 3300042648 | Unclassified | 1686 |
| 161 | Ga0466724_23915 | 3300042649 | Bacteria | 30524 |
| 162 | Ga0466711_026791 | 3300042615 | Bacteria | 8200 |
| 163 | Ga0466711_278242 | 3300042615 | Bacteria | 27669 |
| 164 | Ga0466723_158885 | 3300042618 | Bacteria | 77103 |
| 165 | Ga0466690_141666 | 3300042590 | Bacteria | 8439 |
| 166 | Ga0466699_333178 | 3300042597 | Bacteria | 1148 |
| 167 | Ga0123357_10278585 | 3300009784 | Bacteria | 1732 |
| 168 | Ga0123353_10207503 | 3300010167 | Unclassified | 3076 |
| 169 | Ga0466701_031730 | 3300042598 | Bacteria | 202867 |
| 170 | Ga0466700_274414 | 3300042600 | Bacteria | 1073 |
| 171 | Ga0466719_422552 | 3300042606 | Bacteria | 9953 |
| 172 | Ga0562379_2149 | 3300056790 | Unclassified | 17672 |
| 173 | JGI24700J35501_10930765 | 3300002508 | Bacteria | 22545 |
| 174 | JGI24699J35502_11134179 | 3300002509 | Bacteria | 45584 |
| 175 | CVPL010L_1000073 | 3300002932 | Bacteria | 64100 |
| 176 | Ga0074188_1000210 | 3300005318 | Bacteria | 3953 |
| 177 | Ga0466724_17453 | 3300042649 | Unclassified | 1170 |
| 178 | Ga0466715_121241 | 3300042616 | Bacteria | 11903 |
| 179 | Ga0466723_099825 | 3300042618 | Bacteria | 27702 |
| 180 | Ga0466723_328390 | 3300042618 | Bacteria | 2553 |
| 181 | Ga0466728_012675 | 3300042620 | Bacteria | 2953 |
| 182 | Ga0466728_370899 | 3300042620 | Bacteria | 5518 |
| 183 | Ga0466729_129659 | 3300042621 | Bacteria | 8258 |
| 184 | Ga0264413_149962 | 3300024493 | Bacteria | 3067 |
| 185 | Ga0466657_068092 | 3300042582 | Bacteria | 157899 |
| 186 | Ga0466657_111763 | 3300042582 | Bacteria | 1429 |
| 187 | Ga0466690_301561 | 3300042590 | Unclassified | 8339 |
| 188 | Ga0466692_162916 | 3300042591 | Bacteria | 1871 |
| 189 | Ga0466693_414891 | 3300042592 | Unclassified | 3013 |
| 190 | Ga0466696_499565 | 3300042596 | Bacteria | 1193 |
| 191 | Ga0123355_10625143 | 3300009826 | Bacteria | 1267 |
| 192 | Ga0123353_10001437 | 3300010167 | Bacteria | 29092 |
| 193 | Ga0466719_156765 | 3300042606 | Bacteria | 8159 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.