Protein Family IF04389
Metagenome
Isolate
282
Members
101
Samples
241
Scaffolds
338.42
Avg Length
Representative Sequence
- ID
- 3300042582|Ga0466657_072347|Ga0466657_072347_186_1349
- Length
- 387 aa
- Sequence
- LFYRSLHHQIIFIVLLVQSHFQIFQSSNFQIIQNLLNFADYFFTMAEVISSTLTAKDFVTDQEVRWCPGCGDYSILAQVQRVMPTLGIPKENIAFISGIGCSSRFPYYMETYGVHSIHGRAAAIASGLKASRPELSVWVVTGDGDSLSIGGNHTIHLLRRNFDINVLMFNNQIYGLTKGQYSPTSEKGKVTKSSPFGSIDYSFNPASLALGADGTFVARTMDRDPKHLQAMIARAHQHKGTSFLEIYQNCVIFNDATFDVFTEKATKPEETLFLEQGKPLIFGKDNNKGLRLDGFRPQVVTIGENFSVDDLWIHDESDIYKAQILTRIHDNPSDEGHLPRPFGVFYENNNRPCYEEMMALQLEEAKARKAPNLDALLRGNETWTIQN
Sample Types
Isolate
14.5%
Metagenome
85.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
28.1%
Unclassified
18.8%
Formicidae
14.6%
Kalotermitidae
14.6%
Rhinotermitidae
3.1%
Termopsidae
3.1%
Elmidae
3.1%
Culicidae
2.1%
Armadillidiidae
2.1%
Passalidae
2.1%
Monophlebidae
1.0%
Hydrophilidae
1.0%
Hodotermitidae
1.0%
Artemiidae
1.0%
Tenebrionidae
1.0%
Aphididae
1.0%
Diaspididae
1.0%
Drosophilidae
1.0%
Taxonomy
Archaea
0
Bacteria
253
Eukaryota
0
Viruses
0
Unclassified
29
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2856966858 | Pseudonocardia sp. Ae263_Ps1 | Isolate | Formicidae |
| 2 | 2675903497 | Pseudonocardia sp. EC080610-09 | Isolate | Formicidae |
| 3 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 649989992 | Pseudonocardia sp. P1 | Isolate | Formicidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 14 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 15 | 2585427656 | Endosymbiont of Llaveia axin axin | Isolate | Monophlebidae |
| 16 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 17 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 18 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 19 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 20 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 21 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 22 | 2828301124 | Sphingomonas leidyi DSM 4733 | Isolate | Unclassified |
| 23 | 2856882415 | Pseudonocardia sp. Ae406_Ps2 | Isolate | Formicidae |
| 24 | 2859977607 | Pseudonocardia sp. Ae707_Ps1 | Isolate | Formicidae |
| 25 | 2873589062 | Phycicoccus sp. HDW14 | Isolate | Hydrophilidae |
| 26 | 2900354037 | Nocardia macrotermitis RB20 | Isolate | Termitidae |
| 27 | 2820935937 | Unclassified Actinobacteria Emb289P1bin40 | Isolate | Unclassified |
| 28 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 29 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 30 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 31 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 32 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 33 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 34 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 35 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 36 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 37 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 38 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 39 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 40 | 2820767225 | Unclassified Bacteroidetes Lab288P3bin34 | Isolate | Unclassified |
| 41 | 2820807258 | Unclassified Actinobacteria Nt197P3bin90 | Isolate | Unclassified |
| 42 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 43 | 2671180625 | Pseudonocardia sp. EC080619-01 | Isolate | Formicidae |
| 44 | 2820157249 | Unclassified Proteobacteria Cu122P4bin11 | Isolate | Unclassified |
| 45 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 46 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 47 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 48 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 49 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 50 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 51 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 52 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 53 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 54 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 55 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 56 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 57 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 58 | 8118075156 | Actinosynnema pretiosum DSM 44131 | Isolate | Unclassified |
| 59 | 2856671350 | Pseudonocardia sp. Ae356_Ps1 | Isolate | Formicidae |
| 60 | 2856947901 | Pseudonocardia sp. Ae168_Ps1 | Isolate | Formicidae |
| 61 | 2864899338 | Mycobacteroides chelonae S00154 | Isolate | Elmidae |
| 62 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 63 | 8030347546 | Propionimicrobium sp. PCR01-08-3 | Isolate | Tenebrionidae |
| 64 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 65 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 66 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 67 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 68 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 69 | 2856954254 | Pseudonocardia sp. Ae505_Ps2 | Isolate | Formicidae |
| 70 | 2900368070 | Nocardia aurantia RB56 | Isolate | Termitidae |
| 71 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 72 | 2820219087 | Unclassified Ignavibacteria Th196P3bin14 | Isolate | Unclassified |
| 73 | 2998929858 | Bacteroidetes endosymbiont of Geopemphigus sp. GspS2-BC2016 | Isolate | Aphididae |
| 74 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 75 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 76 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 77 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 78 | 2856960404 | Pseudonocardia sp. Ae706_Ps2 | Isolate | Formicidae |
| 79 | 2856973192 | Pseudonocardia sp. Ae331_Ps2 | Isolate | Formicidae |
| 80 | 2859970369 | Pseudonocardia sp. Ae717_Ps2 | Isolate | Formicidae |
| 81 | 2864976888 | Novosphingobium chloroacetimidivorans S00245 | Isolate | Elmidae |
| 82 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 83 | 2931430189 | Tessaracoccus palaemonis J1M15 | Isolate | |
| 84 | 2547132042 | Pseudonocardia sp. P2 | Isolate | Formicidae |
| 85 | 2718217924 | Pseudonocardia sp. HH130630-07 | Isolate | Formicidae |
| 86 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 87 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 88 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 89 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 90 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 91 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 92 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 93 | 2864955722 | Sphingomonas kyeonggiensis S00224 | Isolate | Elmidae |
| 94 | 2540341063 | Candidatus Uzinura diaspidicola ASNER | Isolate | Diaspididae |
| 95 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 96 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 97 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 98 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 99 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 100 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 101 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_054456 | 3300042612 | Bacteria | 1588 |
| 2 | Ga0466733_035598 | 3300042659 | Bacteria | 10922 |
| 3 | Ga0466733_047054 | 3300042659 | Bacteria | 4013 |
| 4 | Ga0466733_196854 | 3300042659 | Bacteria | 14737 |
| 5 | Ga0466729_283608 | 3300042621 | Bacteria | 7541 |
| 6 | Ga0466729_302522 | 3300042621 | Unclassified | 8052 |
| 7 | Ga0466735_077889 | 3300042624 | Bacteria | 6259 |
| 8 | Ga0466703_095426 | 3300042636 | Unclassified | 4314 |
| 9 | Ga0466703_327591 | 3300042636 | Bacteria | 3135 |
| 10 | Ga0466704_087942 | 3300042643 | Bacteria | 12085 |
| 11 | Ga0466708_024765 | 3300042652 | Bacteria | 33150 |
| 12 | Ga0466725_068261 | 3300042654 | Bacteria | 28182 |
| 13 | Ga0466725_292822 | 3300042654 | Bacteria | 2970 |
| 14 | Ga0123357_10416282 | 3300009784 | Bacteria | 1205 |
| 15 | Ga0123353_10013135 | 3300010167 | Bacteria | 11841 |
| 16 | Ga0123353_10135043 | 3300010167 | Bacteria | 3957 |
| 17 | Ga0123354_10073391 | 3300010882 | Bacteria | 4915 |
| 18 | Ga0160448_100319 | 3300012854 | Bacteria | 18018 |
| 19 | Ga0466657_072347 | 3300042582 | Bacteria | 1460 |
| 20 | Ga0466690_080800 | 3300042590 | Bacteria | 6544 |
| 21 | Ga0466690_107794 | 3300042590 | Bacteria | 4871 |
| 22 | Ga0466690_189885 | 3300042590 | Unclassified | 4969 |
| 23 | Ga0466691_030808 | 3300042593 | Bacteria | 7896 |
| 24 | Ga0466691_090723 | 3300042593 | Bacteria | 7685 |
| 25 | Ga0466699_036917 | 3300042597 | Bacteria | 4736 |
| 26 | Ga0466701_037823 | 3300042598 | Bacteria | 30864 |
| 27 | Ga0466706_155793 | 3300042599 | Bacteria | 34721 |
| 28 | Ga0466706_161607 | 3300042599 | Bacteria | 1900 |
| 29 | Ga0466713_013709 | 3300042602 | Bacteria | 106354 |
| 30 | Ga0466713_017994 | 3300042602 | Unclassified | 6243 |
| 31 | Ga0466713_125883 | 3300042602 | Bacteria | 29710 |
| 32 | Ga0466713_151365 | 3300042602 | Bacteria | 1936 |
| 33 | Ga0466714_001605 | 3300042603 | Bacteria | 24201 |
| 34 | Ga0466714_162403 | 3300042603 | Bacteria | 12595 |
| 35 | Ga0466714_169031 | 3300042603 | Bacteria | 152952 |
| 36 | Ga0466722_102951 | 3300042609 | Unclassified | 13629 |
| 37 | IMNBL1DRAFT_c0029028 | 3300000062 | Bacteria | 2053 |
| 38 | JGI24702J35022_10002022 | 3300002462 | Bacteria | 12497 |
| 39 | Ga0466715_037578 | 3300042616 | Bacteria | 3776 |
| 40 | Ga0466715_253467 | 3300042616 | Bacteria | 15225 |
| 41 | Ga0466723_037591 | 3300042618 | Bacteria | 8313 |
| 42 | Ga0466723_206782 | 3300042618 | Unclassified | 9223 |
| 43 | Ga0466729_142235 | 3300042621 | Bacteria | 1483 |
| 44 | Ga0466705_331041 | 3300042612 | Bacteria | 8032 |
| 45 | Ga0466735_092287 | 3300042624 | Bacteria | 1304 |
| 46 | Ga0466709_198532 | 3300042648 | Bacteria | 44178 |
| 47 | Ga0466708_065643 | 3300042652 | Bacteria | 8807 |
| 48 | Ga0466708_349274 | 3300042652 | Bacteria | 21265 |
| 49 | Ga0123353_10516136 | 3300010167 | Bacteria | 1735 |
| 50 | Ga0466690_246955 | 3300042590 | Unclassified | 2620 |
| 51 | Ga0466696_032657 | 3300042596 | Bacteria | 2557 |
| 52 | Ga0466696_397495 | 3300042596 | Bacteria | 5131 |
| 53 | Ga0466701_064138 | 3300042598 | Bacteria | 7107 |
| 54 | Ga0466706_063624 | 3300042599 | Unclassified | 1067 |
| 55 | Ga0466700_252005 | 3300042600 | Bacteria | 1314 |
| 56 | Ga0466713_021971 | 3300042602 | Bacteria | 15938 |
| 57 | Ga0466714_137996 | 3300042603 | Bacteria | 3840 |
| 58 | Ga0466714_154366 | 3300042603 | Bacteria | 1884 |
| 59 | Ga0466717_103965 | 3300042604 | Bacteria | 1240 |
| 60 | Ga0466716_119061 | 3300042605 | Bacteria | 5234 |
| 61 | Ga0466722_126309 | 3300042609 | Bacteria | 6116 |
| 62 | Ga0466722_176510 | 3300042609 | Bacteria | 4575 |
| 63 | IMNBL1DRAFT_c0015259 | 3300000062 | Unclassified | 3339 |
| 64 | Ga0068305_10068494 | 3300005083 | Bacteria | 37295 |
| 65 | Ga0127649_100690 | 3300009460 | Bacteria | 30572 |
| 66 | Ga0466710_228228 | 3300042613 | Bacteria | 1071 |
| 67 | Ga0466711_037335 | 3300042615 | Bacteria | 5318 |
| 68 | Ga0466715_062922 | 3300042616 | Bacteria | 1184 |
| 69 | Ga0466723_005748 | 3300042618 | Bacteria | 38419 |
| 70 | Ga0466726_023702 | 3300042619 | Bacteria | 9079 |
| 71 | Ga0466728_297321 | 3300042620 | Bacteria | 6400 |
| 72 | Ga0466729_127971 | 3300042621 | Bacteria | 2960 |
| 73 | Ga0466697_067675 | 3300042611 | Bacteria | 3924 |
| 74 | Ga0466729_228261 | 3300042621 | Bacteria | 2033 |
| 75 | Ga0466708_161017 | 3300042652 | Bacteria | 8270 |
| 76 | Ga0466727_095752 | 3300042655 | Bacteria | 5185 |
| 77 | Ga0466727_185677 | 3300042655 | Bacteria | 30193 |
| 78 | Ga0466727_186774 | 3300042655 | Unclassified | 4141 |
| 79 | Ga0123355_10494409 | 3300009826 | Bacteria | 1513 |
| 80 | Ga0123353_10110223 | 3300010167 | Bacteria | 4434 |
| 81 | Ga0123353_10605078 | 3300010167 | Bacteria | 1565 |
| 82 | Ga0160468_100001 | 3300012819 | Bacteria | 1115787 |
| 83 | Ga0466690_084453 | 3300042590 | Bacteria | 13010 |
| 84 | Ga0466690_233503 | 3300042590 | Unclassified | 10076 |
| 85 | Ga0466691_009901 | 3300042593 | Unclassified | 5460 |
| 86 | Ga0466713_064786 | 3300042602 | Bacteria | 6151 |
| 87 | Ga0466713_071975 | 3300042602 | Bacteria | 16826 |
| 88 | Ga0466716_095513 | 3300042605 | Bacteria | 2686 |
| 89 | Ga0466719_072104 | 3300042606 | Bacteria | 4578 |
| 90 | Ga0466722_210881 | 3300042609 | Bacteria | 3718 |
| 91 | IMNBL1DRAFT_c0025564 | 3300000062 | Bacteria | 2262 |
| 92 | JGI24702J35022_10003242 | 3300002462 | Bacteria | 9847 |
| 93 | Ga0466723_090688 | 3300042618 | Bacteria | 20884 |
| 94 | Ga0466728_075649 | 3300042620 | Bacteria | 32231 |
| 95 | Ga0466705_122783 | 3300042612 | Bacteria | 9723 |
| 96 | Ga0466705_137505 | 3300042612 | Bacteria | 15026 |
| 97 | Ga0466733_105839 | 3300042659 | Bacteria | 1390 |
| 98 | Ga0466735_159877 | 3300042624 | Bacteria | 16168 |
| 99 | Ga0466703_198414 | 3300042636 | Bacteria | 1397 |
| 100 | Ga0466725_061032 | 3300042654 | Bacteria | 120083 |
| 101 | Ga0123355_10153210 | 3300009826 | Bacteria | 3495 |
| 102 | Ga0123353_10000005 | 3300010167 | Bacteria | 308504 |
| 103 | Ga0466690_196502 | 3300042590 | Bacteria | 6055 |
| 104 | Ga0466690_198742 | 3300042590 | Unclassified | 11193 |
| 105 | Ga0466692_053324 | 3300042591 | Bacteria | 44513 |
| 106 | Ga0466695_007199 | 3300042595 | Bacteria | 1369 |
| 107 | Ga0466706_050819 | 3300042599 | Bacteria | 7351 |
| 108 | Ga0466713_113029 | 3300042602 | Bacteria | 128375 |
| 109 | Ga0466713_131705 | 3300042602 | Bacteria | 19463 |
| 110 | Ga0466714_129699 | 3300042603 | Bacteria | 4925 |
| 111 | Ga0466716_356407 | 3300042605 | Bacteria | 14494 |
| 112 | Ga0466721_010304 | 3300042608 | Bacteria | 27154 |
| 113 | 2227480184 | 2225789004 | Bacteria | 78831 |
| 114 | 2227535714 | 2225789004 | Bacteria | 63282 |
| 115 | IMNBL1DRAFT_c0001114 | 3300000062 | Bacteria | 20562 |
| 116 | JGI24705J35276_12224450 | 3300002504 | Bacteria | 2612 |
| 117 | Ga0466715_593641 | 3300042616 | Bacteria | 3790 |
| 118 | Ga0466723_212584 | 3300042618 | Bacteria | 13734 |
| 119 | Ga0466723_347887 | 3300042618 | Unclassified | 6635 |
| 120 | Ga0466729_036367 | 3300042621 | Bacteria | 20996 |
| 121 | Ga0466705_024319 | 3300042612 | Bacteria | 12627 |
| 122 | Ga0466733_165720 | 3300042659 | Bacteria | 10796 |
| 123 | Ga0466733_202552 | 3300042659 | Bacteria | 11158 |
| 124 | Ga0466735_066567 | 3300042624 | Bacteria | 5878 |
| 125 | Ga0466703_245398 | 3300042636 | Bacteria | 4017 |
| 126 | Ga0466709_232676 | 3300042648 | Bacteria | 9270 |
| 127 | Ga0466724_57946 | 3300042649 | Bacteria | 1639 |
| 128 | Ga0466708_185006 | 3300042652 | Bacteria | 28025 |
| 129 | Ga0466725_425631 | 3300042654 | Bacteria | 2381 |
| 130 | Ga0160433_100329 | 3300012846 | Bacteria | 29162 |
| 131 | Ga0466690_036244 | 3300042590 | Unclassified | 4704 |
| 132 | Ga0466692_021569 | 3300042591 | Bacteria | 21084 |
| 133 | Ga0466691_036758 | 3300042593 | Bacteria | 14496 |
| 134 | Ga0466696_026649 | 3300042596 | Bacteria | 18768 |
| 135 | Ga0466696_039930 | 3300042596 | Bacteria | 11069 |
| 136 | Ga0466706_013398 | 3300042599 | Bacteria | 91518 |
| 137 | Ga0466706_123047 | 3300042599 | Bacteria | 432554 |
| 138 | Ga0466706_176587 | 3300042599 | Bacteria | 2606 |
| 139 | Ga0466706_282704 | 3300042599 | Bacteria | 3547 |
| 140 | Ga0466707_368983 | 3300042601 | Bacteria | 3659 |
| 141 | Ga0466713_062271 | 3300042602 | Bacteria | 21270 |
| 142 | Ga0466719_508305 | 3300042606 | Bacteria | 4842 |
| 143 | Ga0466720_209113 | 3300042607 | Bacteria | 1221 |
| 144 | Ga0466697_031887 | 3300042611 | Bacteria | 2476 |
| 145 | Ga0072941_1343902 | 3300005201 | Bacteria | 1537 |
| 146 | Ga0466711_265678 | 3300042615 | Unclassified | 13611 |
| 147 | Ga0466711_389530 | 3300042615 | Bacteria | 9654 |
| 148 | Ga0466723_088569 | 3300042618 | Bacteria | 17877 |
| 149 | Ga0466728_342328 | 3300042620 | Bacteria | 6231 |
| 150 | Ga0466697_113398 | 3300042611 | Unclassified | 1279 |
| 151 | Ga0466697_154581 | 3300042611 | Bacteria | 1514 |
| 152 | Ga0466705_190600 | 3300042612 | Bacteria | 10669 |
| 153 | Ga0466733_051786 | 3300042659 | Bacteria | 21976 |
| 154 | Ga0466729_230630 | 3300042621 | Bacteria | 7962 |
| 155 | Ga0466734_063652 | 3300042623 | Bacteria | 4806 |
| 156 | Ga0466735_005129 | 3300042624 | Unclassified | 4193 |
| 157 | Ga0466703_223931 | 3300042636 | Bacteria | 5372 |
| 158 | Ga0466704_497965 | 3300042643 | Bacteria | 8758 |
| 159 | Ga0466704_529249 | 3300042643 | Bacteria | 10689 |
| 160 | Ga0466708_267723 | 3300042652 | Bacteria | 7880 |
| 161 | Ga0466725_302793 | 3300042654 | Bacteria | 49393 |
| 162 | Ga0123353_10013529 | 3300010167 | Bacteria | 11695 |
| 163 | Ga0123353_10032338 | 3300010167 | Bacteria | 8123 |
| 164 | Ga0160460_100011 | 3300012845 | Bacteria | 482161 |
| 165 | Ga0466690_033015 | 3300042590 | Unclassified | 3730 |
| 166 | Ga0466696_035970 | 3300042596 | Bacteria | 14065 |
| 167 | Ga0466696_316853 | 3300042596 | Bacteria | 16717 |
| 168 | Ga0466701_018124 | 3300042598 | Bacteria | 4428 |
| 169 | Ga0466701_096972 | 3300042598 | Bacteria | 23134 |
| 170 | Ga0466713_153034 | 3300042602 | Bacteria | 11346 |
| 171 | Ga0466717_001943 | 3300042604 | Bacteria | 1769 |
| 172 | Ga0466722_183668 | 3300042609 | Bacteria | 4823 |
| 173 | IMNBL1DRAFT_c0000079 | 3300000062 | Bacteria | 87281 |
| 174 | IMNBL1DRAFT_c0006621 | 3300000062 | Bacteria | 6282 |
| 175 | JGI24696J40584_12955185 | 3300002834 | Bacteria | 2782 |
| 176 | Ga0105524_102959 | 3300007733 | Bacteria | 2312 |
| 177 | Ga0466715_142733 | 3300042616 | Unclassified | 12325 |
| 178 | Ga0466726_202265 | 3300042619 | Bacteria | 9601 |
| 179 | Ga0466732_091180 | 3300042656 | Bacteria | 1816 |
| 180 | Ga0466733_035403 | 3300042659 | Bacteria | 5561 |
| 181 | Ga0466733_116382 | 3300042659 | Bacteria | 2151 |
| 182 | Ga0466703_063634 | 3300042636 | Bacteria | 9160 |
| 183 | Ga0466703_238767 | 3300042636 | Bacteria | 31663 |
| 184 | Ga0466703_265755 | 3300042636 | Bacteria | 4274 |
| 185 | Ga0466709_275063 | 3300042648 | Bacteria | 136526 |
| 186 | Ga0123356_10083609 | 3300010049 | Unclassified | 3024 |
| 187 | Ga0466657_315427 | 3300042582 | Bacteria | 5107 |
| 188 | Ga0466691_034593 | 3300042593 | Bacteria | 19566 |
| 189 | Ga0466696_140422 | 3300042596 | Bacteria | 7429 |
| 190 | Ga0466696_179349 | 3300042596 | Bacteria | 9584 |
| 191 | Ga0466696_262277 | 3300042596 | Bacteria | 8026 |
| 192 | Ga0466706_085981 | 3300042599 | Unclassified | 5555 |
| 193 | Ga0466706_170058 | 3300042599 | Bacteria | 36727 |
| 194 | Ga0466713_038278 | 3300042602 | Bacteria | 6878 |
| 195 | Ga0466713_135605 | 3300042602 | Bacteria | 1985 |
| 196 | Ga0466716_084416 | 3300042605 | Unclassified | 5620 |
| 197 | Ga0466719_466076 | 3300042606 | Bacteria | 15076 |
| 198 | Ga0466722_014997 | 3300042609 | Unclassified | 7165 |
| 199 | 2227608792 | 2225789004 | Unclassified | 2278 |
| 200 | IMNBL1DRAFT_c0006250 | 3300000062 | Bacteria | 6543 |
| 201 | JGI24702J35022_10012462 | 3300002462 | Bacteria | 4727 |
| 202 | Ga0072941_1138801 | 3300005201 | Bacteria | 3857 |
| 203 | Ga0105005_1014617 | 3300007505 | Bacteria | 3723 |
| 204 | Ga0466711_265272 | 3300042615 | Bacteria | 4306 |
| 205 | Ga0466715_083674 | 3300042616 | Bacteria | 21996 |
| 206 | Ga0466715_321736 | 3300042616 | Bacteria | 10329 |
| 207 | Ga0466715_635297 | 3300042616 | Bacteria | 2232 |
| 208 | Ga0466728_475646 | 3300042620 | Unclassified | 11401 |
| 209 | Ga0466729_116860 | 3300042621 | Bacteria | 1290 |
| 210 | Ga0466705_208622 | 3300042612 | Bacteria | 6768 |
| 211 | Ga0466733_174650 | 3300042659 | Bacteria | 11050 |
| 212 | Ga0466704_601523 | 3300042643 | Bacteria | 55044 |
| 213 | Ga0466709_133867 | 3300042648 | Bacteria | 7130 |
| 214 | Ga0466708_105478 | 3300042652 | Bacteria | 9356 |
| 215 | Ga0466727_258221 | 3300042655 | Bacteria | 9531 |
| 216 | Ga0123356_10139999 | 3300010049 | Bacteria | 2386 |
| 217 | Ga0123356_10147912 | 3300010049 | Bacteria | 2328 |
| 218 | Ga0123353_10045511 | 3300010167 | Bacteria | 6964 |
| 219 | Ga0123353_10097087 | 3300010167 | Bacteria | 4748 |
| 220 | Ga0265387_1007581 | 3300024582 | Bacteria | 1457 |
| 221 | Ga0466657_265850 | 3300042582 | Bacteria | 4451 |
| 222 | Ga0466690_125764 | 3300042590 | Bacteria | 5989 |
| 223 | Ga0466693_410640 | 3300042592 | Bacteria | 1353 |
| 224 | Ga0466691_186282 | 3300042593 | Bacteria | 110439 |
| 225 | Ga0466691_198071 | 3300042593 | Bacteria | 9384 |
| 226 | Ga0466701_024370 | 3300042598 | Bacteria | 3375 |
| 227 | Ga0466701_059766 | 3300042598 | Bacteria | 23149 |
| 228 | Ga0466707_109905 | 3300042601 | Bacteria | 11220 |
| 229 | Ga0466707_249217 | 3300042601 | Bacteria | 13258 |
| 230 | Ga0466707_352331 | 3300042601 | Bacteria | 47175 |
| 231 | Ga0466716_125698 | 3300042605 | Unclassified | 3042 |
| 232 | Ga0466719_475322 | 3300042606 | Unclassified | 2132 |
| 233 | Ga0466722_127581 | 3300042609 | Bacteria | 24919 |
| 234 | IMNBL1DRAFT_c0031759 | 3300000062 | Bacteria | 1915 |
| 235 | Ga0466710_341933 | 3300042613 | Bacteria | 2804 |
| 236 | Ga0466711_371425 | 3300042615 | Bacteria | 8631 |
| 237 | Ga0466715_319238 | 3300042616 | Bacteria | 9474 |
| 238 | Ga0466715_333693 | 3300042616 | Bacteria | 1674 |
| 239 | Ga0466723_139478 | 3300042618 | Unclassified | 7778 |
| 240 | Ga0466728_091812 | 3300042620 | Bacteria | 8396 |
| 241 | Ga0466728_112906 | 3300042620 | Bacteria | 3506 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02775 | TPP_enzyme_C | Thiamine pyrophosphate enzyme, C-terminal TPP binding domain | 99 | 246 | 0.91 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.