Protein Family IF04366
Metagenome
Isolate
147
Members
55
Samples
137
Scaffolds
148.76
Avg Length
Representative Sequence
- ID
- 3300042550|Ga0466656_208045|Ga0466656_208045_813_1316
- Length
- 167 aa
- Sequence
- MSSEVKTSPCYDDKKIIFMNLFDQISADIKTAMLAKDAIKLDALRGIKKEFLEAKTAKGSDGELSDETAIKIITKMVKQRKDAAEIFSQQNRPDLAEKELLEVVAISPYLPQQLSETELETIIKQIITDVGAEGAKDMGKVMGVASKQLAGKAEGRMISEVVKRSLS
Sample Types
Isolate
6.8%
Metagenome
93.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.9%
Kalotermitidae
24.1%
Unclassified
11.1%
Blattidae
7.4%
Termopsidae
5.6%
Rhinotermitidae
3.7%
Passalidae
3.7%
Hodotermitidae
1.9%
Apidae
1.9%
Elmidae
1.9%
Taxonomy
Archaea
0
Bacteria
136
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 10 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 11 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 12 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 13 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 14 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 15 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 16 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 17 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 18 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 19 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 20 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 21 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 22 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 23 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 24 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 25 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 26 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 27 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 28 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 29 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 30 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 31 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 32 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 33 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 34 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 35 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 36 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 37 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 38 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 39 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 40 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 41 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 42 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 43 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 44 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 45 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 46 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 47 | 2998907766 | Penaeicola halotolerans LMIT005 | Isolate | |
| 48 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 49 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 50 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 51 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 52 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 53 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 54 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 55 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466714_028693 | 3300042603 | Bacteria | 3708 |
| 2 | Ga0466716_194925 | 3300042605 | Bacteria | 2072 |
| 3 | Ga0466719_521582 | 3300042606 | Bacteria | 7232 |
| 4 | JGI24705J35276_12136356 | 3300002504 | Unclassified | 1123 |
| 5 | JGI24699J35502_11133865 | 3300002509 | Bacteria | 17498 |
| 6 | Ga0466735_039590 | 3300042624 | Bacteria | 1955 |
| 7 | Ga0466735_124743 | 3300042624 | Bacteria | 8366 |
| 8 | Ga0466710_111237 | 3300042613 | Bacteria | 1263 |
| 9 | Ga0466710_122924 | 3300042613 | Bacteria | 5284 |
| 10 | Ga0466715_009808 | 3300042616 | Bacteria | 10434 |
| 11 | Ga0466728_025249 | 3300042620 | Bacteria | 1207 |
| 12 | Ga0466693_012982 | 3300042592 | Bacteria | 2137 |
| 13 | Ga0123353_10661345 | 3300010167 | Bacteria | 1476 |
| 14 | Ga0123354_10135477 | 3300010882 | Bacteria | 3082 |
| 15 | Ga0123354_10139674 | 3300010882 | Bacteria | 3005 |
| 16 | Ga0123354_10199024 | 3300010882 | Bacteria | 2211 |
| 17 | Ga0123354_10278727 | 3300010882 | Bacteria | 1629 |
| 18 | Ga0466706_012239 | 3300042599 | Bacteria | 4570 |
| 19 | Ga0466700_487709 | 3300042600 | Bacteria | 3600 |
| 20 | Ga0466713_055725 | 3300042602 | Bacteria | 54491 |
| 21 | Ga0466714_036742 | 3300042603 | Bacteria | 1173 |
| 22 | Ga0466714_099855 | 3300042603 | Bacteria | 53238 |
| 23 | Ga0466719_383063 | 3300042606 | Bacteria | 2743 |
| 24 | JGI24702J35022_10027474 | 3300002462 | Bacteria | 3061 |
| 25 | Ga0466703_344761 | 3300042636 | Bacteria | 1729 |
| 26 | Ga0466705_514262 | 3300042612 | Bacteria | 13223 |
| 27 | Ga0466711_008885 | 3300042615 | Bacteria | 6751 |
| 28 | Ga0466715_227783 | 3300042616 | Bacteria | 2594 |
| 29 | Ga0466723_011214 | 3300042618 | Bacteria | 7629 |
| 30 | Ga0466726_300885 | 3300042619 | Bacteria | 2392 |
| 31 | Ga0466726_379681 | 3300042619 | Bacteria | 2913 |
| 32 | Ga0466728_025095 | 3300042620 | Bacteria | 11331 |
| 33 | Ga0466728_093907 | 3300042620 | Bacteria | 21414 |
| 34 | Ga0466728_109000 | 3300042620 | Bacteria | 3683 |
| 35 | Ga0466657_145988 | 3300042582 | Bacteria | 1047 |
| 36 | Ga0466696_024859 | 3300042596 | Bacteria | 4740 |
| 37 | Ga0123356_13712424 | 3300010049 | Bacteria | 528 |
| 38 | Ga0123353_10237392 | 3300010167 | Bacteria | 2836 |
| 39 | Ga0123353_10345330 | 3300010167 | Bacteria | 2246 |
| 40 | Ga0123353_10615493 | 3300010167 | Bacteria | 1548 |
| 41 | Ga0466733_105223 | 3300042659 | Bacteria | 1832 |
| 42 | Ga0466707_324549 | 3300042601 | Bacteria | 1467 |
| 43 | Ga0466714_051125 | 3300042603 | Bacteria | 52861 |
| 44 | Ga0466722_018092 | 3300042609 | Bacteria | 1568 |
| 45 | Ga0466722_164712 | 3300042609 | Bacteria | 2696 |
| 46 | Ga0466708_111371 | 3300042652 | Bacteria | 3174 |
| 47 | Ga0466727_138746 | 3300042655 | Bacteria | 1440 |
| 48 | Ga0466727_284841 | 3300042655 | Bacteria | 2037 |
| 49 | Ga0466696_008900 | 3300042596 | Bacteria | 14230 |
| 50 | Ga0123357_10515517 | 3300009784 | Bacteria | 981 |
| 51 | Ga0123356_10900137 | 3300010049 | Unclassified | 1056 |
| 52 | Ga0123356_12808748 | 3300010049 | Unclassified | 609 |
| 53 | Ga0123353_10429282 | 3300010167 | Bacteria | 1955 |
| 54 | Ga0466697_074455 | 3300042611 | Bacteria | 2935 |
| 55 | Ga0466701_072422 | 3300042598 | Bacteria | 50719 |
| 56 | Ga0466707_042226 | 3300042601 | Bacteria | 5459 |
| 57 | Ga0466707_056939 | 3300042601 | Bacteria | 7871 |
| 58 | Ga0466722_098659 | 3300042609 | Bacteria | 24477 |
| 59 | Ga0074263_138480 | 3300005485 | Bacteria | 843 |
| 60 | Ga0466734_032507 | 3300042623 | Bacteria | 2979 |
| 61 | Ga0466727_068010 | 3300042655 | Bacteria | 7330 |
| 62 | Ga0466715_098941 | 3300042616 | Bacteria | 40534 |
| 63 | Ga0466723_023030 | 3300042618 | Bacteria | 16011 |
| 64 | Ga0466726_301754 | 3300042619 | Bacteria | 4893 |
| 65 | Ga0466656_045641 | 3300042550 | Bacteria | 1512 |
| 66 | Ga0466656_152782 | 3300042550 | Bacteria | 2681 |
| 67 | Ga0466656_208045 | 3300042550 | Bacteria | 3940 |
| 68 | Ga0466657_137821 | 3300042582 | Bacteria | 3135 |
| 69 | Ga0466690_324999 | 3300042590 | Bacteria | 3544 |
| 70 | Ga0466696_339548 | 3300042596 | Bacteria | 2028 |
| 71 | Ga0123356_10644156 | 3300010049 | Bacteria | 1226 |
| 72 | Ga0123356_11024753 | 3300010049 | Bacteria | 995 |
| 73 | Ga0123356_11184305 | 3300010049 | Unclassified | 931 |
| 74 | Ga0123356_12907278 | 3300010049 | Unclassified | 599 |
| 75 | Ga0123354_10246304 | 3300010882 | Unclassified | 1824 |
| 76 | Ga0466705_303651 | 3300042612 | Bacteria | 5927 |
| 77 | Ga0466733_007435 | 3300042659 | Bacteria | 1622 |
| 78 | Ga0466733_105264 | 3300042659 | Bacteria | 1375 |
| 79 | Ga0466733_118407 | 3300042659 | Bacteria | 19866 |
| 80 | Ga0466707_137968 | 3300042601 | Bacteria | 35577 |
| 81 | Ga0466717_312688 | 3300042604 | Bacteria | 2450 |
| 82 | Ga0466716_306882 | 3300042605 | Bacteria | 2274 |
| 83 | IMNBGM34_c003416 | 3300000036 | Bacteria | 2198 |
| 84 | JGI24696J40584_12922470 | 3300002834 | Bacteria | 1365 |
| 85 | Ga0068305_10039966 | 3300005083 | Bacteria | 22305 |
| 86 | Ga0466729_264329 | 3300042621 | Bacteria | 8756 |
| 87 | Ga0466703_050395 | 3300042636 | Bacteria | 8463 |
| 88 | Ga0466711_411620 | 3300042615 | Bacteria | 1460 |
| 89 | Ga0466715_461898 | 3300042616 | Bacteria | 12878 |
| 90 | Ga0466723_121625 | 3300042618 | Bacteria | 2831 |
| 91 | Ga0466690_341355 | 3300042590 | Bacteria | 23370 |
| 92 | Ga0466696_365827 | 3300042596 | Unclassified | 1363 |
| 93 | Ga0123356_11929040 | 3300010049 | Bacteria | 736 |
| 94 | Ga0123353_10657203 | 3300010167 | Bacteria | 1482 |
| 95 | Ga0123353_12585836 | 3300010167 | Unclassified | 601 |
| 96 | Ga0466733_062710 | 3300042659 | Bacteria | 13440 |
| 97 | Ga0466733_216481 | 3300042659 | Bacteria | 14138 |
| 98 | Ga0466714_014534 | 3300042603 | Bacteria | 1081 |
| 99 | Ga0466714_128548 | 3300042603 | Unclassified | 2554 |
| 100 | Ga0466716_254671 | 3300042605 | Bacteria | 2250 |
| 101 | Ga0466722_202537 | 3300042609 | Bacteria | 2043 |
| 102 | Ga0123357_10000085 | 3300009784 | Bacteria | 75372 |
| 103 | Ga0466735_113699 | 3300042624 | Bacteria | 2675 |
| 104 | Ga0466696_175589 | 3300042596 | Bacteria | 53710 |
| 105 | Ga0466696_370106 | 3300042596 | Bacteria | 1632 |
| 106 | Ga0123356_10771716 | 3300010049 | Bacteria | 1132 |
| 107 | Ga0123356_11136503 | 3300010049 | Bacteria | 948 |
| 108 | Ga0123356_11307414 | 3300010049 | Bacteria | 888 |
| 109 | Ga0123353_10157341 | 3300010167 | Bacteria | 3620 |
| 110 | Ga0123353_10470314 | 3300010167 | Bacteria | 1843 |
| 111 | Ga0466706_193089 | 3300042599 | Bacteria | 58339 |
| 112 | Ga0466700_317930 | 3300042600 | Bacteria | 13448 |
| 113 | Ga0466713_012237 | 3300042602 | Bacteria | 8194 |
| 114 | Ga0466714_052255 | 3300042603 | Bacteria | 17302 |
| 115 | Ga0466722_123284 | 3300042609 | Bacteria | 1293 |
| 116 | IMNBGM34_c000072 | 3300000036 | Bacteria | 28080 |
| 117 | Ga0466735_190748 | 3300042624 | Bacteria | 1176 |
| 118 | Ga0466703_315201 | 3300042636 | Bacteria | 5627 |
| 119 | Ga0466709_101317 | 3300042648 | Bacteria | 5608 |
| 120 | Ga0466729_046251 | 3300042621 | Unclassified | 1349 |
| 121 | Ga0466690_101438 | 3300042590 | Bacteria | 19787 |
| 122 | Ga0123356_10053471 | 3300010049 | Bacteria | 3758 |
| 123 | Ga0123356_13155331 | 3300010049 | Bacteria | 574 |
| 124 | Ga0123353_10157219 | 3300010167 | Bacteria | 3622 |
| 125 | Ga0123353_10299270 | 3300010167 | Bacteria | 2457 |
| 126 | Ga0123353_10447376 | 3300010167 | Unclassified | 1903 |
| 127 | Ga0466713_152619 | 3300042602 | Bacteria | 16856 |
| 128 | Ga0466719_067594 | 3300042606 | Bacteria | 2591 |
| 129 | IMNBL1DRAFT_c0003722 | 3300000062 | Bacteria | 9569 |
| 130 | JGI24696J40584_12686674 | 3300002834 | Bacteria | 724 |
| 131 | Ga0072940_1241030 | 3300005200 | Bacteria | 2226 |
| 132 | Ga0466703_028861 | 3300042636 | Bacteria | 6137 |
| 133 | Ga0466704_112999 | 3300042643 | Bacteria | 5661 |
| 134 | Ga0466708_194771 | 3300042652 | Bacteria | 7897 |
| 135 | Ga0466726_172075 | 3300042619 | Bacteria | 3507 |
| 136 | Ga0466726_281486 | 3300042619 | Bacteria | 9395 |
| 137 | Ga0123356_10511481 | 3300010049 | Bacteria | 1358 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF09424 | YqeY | Yqey-like protein | 23 | 166 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.