Protein Family IF04334

Metagenome Isolate
351 Members
128 Samples
282 Scaffolds
333.61 Avg Length

🧬 Representative Sequence

ID
3300038395|Ga0415639_181117|Ga0415639_181117_59_1165
Length
368 aa
Sequence
MKKVIFSAIQPTNTPHLGNYLGALKNWVTMQEDYDCIYSVADLHAITIRQEPANFRAQIRETYAILMAIGIDVEKTTLFVQSHNPNHAELAWILSCYTQFGELSRMTQFKDKSAKLSKDRDPGQPSEIIDGQCRANHSVNVNAGLFTYPVLQAADILLYQADLVPIGADQKQHLELSRDIAVRFNNAYSPTFTVPEPYIPGMVKPSADGHTATGSAAAAKIMSLTTPDKKMSKSDENPNASVSVLDERDVIIKKFKRAVTDSGSEIVYNENDPAKAGINNLISVYTSVSGKTVTDCEKEFAGKGYGDFKLGVGEAVADTFAPIREEYARLTADKAFLESCMKSGAEKAVRASSKTLRKVYKKVGFIER

πŸ“Š Sample Types

Isolate 19.7%
Metagenome 80.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 41.9%
Termitidae 19.4%
Kalotermitidae 8.1%
Elmidae 4.0%
Termopsidae 2.4%
Tenebrionidae 2.4%
Drosophilidae 2.4%
Culicidae 2.4%
Curculionidae 2.4%
Pteromalidae 1.6%
Rhinotermitidae 1.6%
Tephritidae 1.6%
Plutellidae 1.6%
Armadillidiidae 1.6%
Aleyrodidae 1.6%
Passalidae 1.6%
Hodotermitidae 0.8%
Reduviidae 0.8%
Hippoboscidae 0.8%
Cerambycidae 0.8%

🌳 Taxonomy

Archaea 0
Bacteria 329
Eukaryota 0
Viruses 0
Unclassified 22

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2509276035 Saprospira grandis HR1, DSM 2844 Isolate
2 2510065002 Arsenophonus sp. ArN Isolate Pteromalidae
3 2820244222 Unclassified Firmicutes Th196P3bin75 Isolate Unclassified
4 2820296961 Unclassified Firmicutes Th196P3bin102 Isolate Unclassified
5 2820432912 Unclassified Firmicutes Lab288P3bin219 Isolate Unclassified
6 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
7 2820566695 Unclassified Firmicutes Emb289P3bin50 Isolate Unclassified
8 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
9 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
10 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
11 3300005318 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut Metagenome Drosophilidae
12 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
13 2864764899 Aeromonas fluvialis S00019 Isolate Elmidae
14 2864768727 Aeromonas veronii S00020 Isolate Elmidae
15 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
16 2820339298 Unclassified Firmicutes Nt197P3bin68 Isolate Unclassified
17 2820620956 Unclassified Firmicutes Emb289P1bin128 Isolate Unclassified
18 2597490379 Entomoplasma freundtii ATCC 51999 Isolate Unclassified
19 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
20 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
21 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
22 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
23 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
24 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
25 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
26 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
27 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
28 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
29 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
30 2864791955 Aeromonas veronii S00030 Isolate Elmidae
31 2901296437 Erwinia dacicola Oroville Isolate Tephritidae
32 2510065003 Arsenophonus triatominarum ArT Isolate Reduviidae
33 2820220859 Unclassified Firmicutes Th196P4bin59 Isolate Unclassified
34 2820252425 Unclassified Firmicutes Th196P3bin6 Isolate Unclassified
35 2820259584 Unclassified Firmicutes Th196P3bin43 Isolate Unclassified
36 2820288918 Unclassified Firmicutes Th196P3bin137 Isolate Unclassified
37 2820294436 Unclassified Firmicutes Th196P3bin104 Isolate Unclassified
38 2820387566 Unclassified Firmicutes Nt197P1bin1 Isolate Unclassified
39 2820469612 Unclassified Firmicutes Lab288P1bin92 Isolate Unclassified
40 2820499546 Unclassified Firmicutes Lab288P1bin54 Isolate Unclassified
41 2820569216 Unclassified Firmicutes Emb289P3bin33 Isolate Unclassified
42 2820596822 Unclassified Firmicutes Emb289P1bin58 Isolate Unclassified
43 2820688768 Unclassified Firmicutes Co191P1bin74 Isolate Unclassified
44 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
45 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
46 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
47 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
48 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
49 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
50 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
51 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
52 3300035363 Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut Metagenome Plutellidae
53 2871771314 Pantoea sp. Ae16 Isolate Culicidae
54 2524614872 Arsenophonus nasoniae DSM 15247 Isolate Unclassified
55 2820442516 Unclassified Firmicutes Lab288P3bin200 Isolate Unclassified
56 2820537337 Unclassified Firmicutes Lab288P1bin137 Isolate Unclassified
57 2820551407 Unclassified Firmicutes Emb289P4bin38 Isolate Unclassified
58 2820594669 Unclassified Firmicutes Emb289P1bin61 Isolate Unclassified
59 2820683647 Unclassified Firmicutes Co191P1bin82 Isolate Unclassified
60 2820098966 Unclassified Proteobacteria Lab288P1bin49 Isolate Unclassified
61 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
62 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
63 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
64 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
65 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
66 2510065004 Arsenophonus melophagi ArM Isolate Hippoboscidae
67 2820229114 Unclassified Firmicutes Th196P4bin40 Isolate Unclassified
68 2820520043 Unclassified Firmicutes Lab288P1bin24 Isolate Unclassified
69 2820661146 Unclassified Firmicutes Co191P3bin61 Isolate Unclassified
70 2820707375 Unclassified Firmicutes Co191P1bin31 Isolate Unclassified
71 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
72 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
73 8062647588 Nissabacter archeti JGM97 Isolate Drosophilidae
74 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
75 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
76 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
77 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
78 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
79 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
80 2833859439 Arsenophonus endosymbiont of Aleurodicus dispersus ARAD Isolate Aleyrodidae
81 2836755666 Arsenophonus nasoniae FIN Isolate Pteromalidae
82 2820231849 Unclassified Firmicutes Th196P4bin1 Isolate Unclassified
83 2820250282 Unclassified Firmicutes Th196P3bin66 Isolate Unclassified
84 2820319488 Unclassified Firmicutes Nt197P3bin88 Isolate Unclassified
85 2820360414 Unclassified Firmicutes Nt197P3bin121 Isolate Unclassified
86 2820375548 Unclassified Firmicutes Nt197P1bin8 Isolate Unclassified
87 2820504582 Unclassified Firmicutes Lab288P1bin5 Isolate Unclassified
88 2820563109 Unclassified Firmicutes Emb289P3bin58 Isolate Unclassified
89 2820587002 Unclassified Firmicutes Emb289P1bin94 Isolate Unclassified
90 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
91 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
92 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
93 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
94 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
95 2971189173 Yersinia pestis A-1249 Isolate Unclassified
96 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
97 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
98 3300007767 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut Metagenome Drosophilidae
99 3300009457 Microbial communities of aphids from Cornus stolonifera in Ithaca, NY, USA - Anoecia oenotherae NM10041110_01 seqcov Metagenome
100 2822856742 Enterobacter cancerogenus CR-Eb1 Isolate Unclassified
101 2848317263 Arsenophonus endosymbiont of Aleurodicus floccissimus ARAF Isolate Aleyrodidae
102 2864777284 Aeromonas hydrophila S00023 Isolate Elmidae
103 2864796242 Aeromonas hydrophilia S00040 Isolate Elmidae
104 2898975184 Erwinia dacicola IL Isolate Tephritidae
105 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
106 2521172698 Candidatus Blochmannia chromaiodes 640 Isolate Unclassified
107 2820336130 Unclassified Firmicutes Nt197P3bin70 Isolate Unclassified
108 2820570671 Unclassified Firmicutes Emb289P3bin19 Isolate Unclassified
109 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
110 8028002147 Enterobacter sp. 10-1 Isolate Cerambycidae
111 8099192374 Erwinia typographi IC4 Isolate Curculionidae
112 8110023836 Enterobacterales bacterium BIT-L3 Isolate Tenebrionidae
113 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
114 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
115 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
116 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
117 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
118 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
119 3300035364 Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut Metagenome Plutellidae
120 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
121 2820282995 Unclassified Firmicutes Th196P3bin147 Isolate Unclassified
122 2820362221 Unclassified Firmicutes Nt197P3bin116 Isolate Unclassified
123 2820382897 Unclassified Firmicutes Nt197P1bin3 Isolate Unclassified
124 2820464928 Unclassified Firmicutes Lab288P3bin121 Isolate Unclassified
125 2820681712 Unclassified Firmicutes Co191P1bin84 Isolate Unclassified
126 3300009461 Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov Metagenome
127 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
128 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123357_10077718 3300009784 Bacteria 4376
2 Ga0123355_10293547 3300009826 Bacteria 2227
3 Ga0123356_10002491 3300010049 Bacteria 19663
4 Ga0123356_10017028 3300010049 Bacteria 6919
5 Ga0123356_10384562 3300010049 Bacteria 1537
6 Ga0123356_10624409 3300010049 Bacteria 1243
7 Ga0123353_10000140 3300010167 Bacteria 88306
8 Ga0123353_10078828 3300010167 Bacteria 5295
9 Ga0123353_10094066 3300010167 Bacteria 4829
10 Ga0123353_10225255 3300010167 Unclassified 2928
11 Ga0123353_10382641 3300010167 Unclassified 2104
12 Ga0123353_10536703 3300010167 Bacteria 1692
13 Ga0123354_10009620 3300010882 Bacteria 14827
14 Ga0466706_062708 3300042599 Bacteria 18347
15 Ga0466706_099734 3300042599 Bacteria 3716
16 Ga0466706_119586 3300042599 Unclassified 5854
17 Ga0466706_158261 3300042599 Bacteria 2216
18 Ga0466706_235536 3300042599 Unclassified 17540
19 Ga0466706_250408 3300042599 Bacteria 38512
20 Ga0466714_071927 3300042603 Bacteria 1155
21 Ga0466714_101503 3300042603 Bacteria 36908
22 Ga0466721_263616 3300042608 Bacteria 1069
23 Ga0466721_340781 3300042608 Bacteria 17852
24 Ga0466722_165359 3300042609 Bacteria 1266
25 2227165826 2225789004 Bacteria 1540
26 JGI24695J34938_10000057 3300002450 Bacteria 89669
27 JGI24702J35022_10004973 3300002462 Bacteria 7845
28 JGI24702J35022_10077077 3300002462 Bacteria 1802
29 Ga0123357_10001669 3300009784 Unclassified 23867
30 Ga0466705_316709 3300042612 Bacteria 57160
31 Ga0123355_10000446 3300009826 Bacteria 54229
32 Ga0123355_10024962 3300009826 Bacteria 9618
33 Ga0123355_10025235 3300009826 Bacteria 9569
34 Ga0123355_10265101 3300009826 Bacteria 2396
35 Ga0123355_10525346 3300009826 Bacteria 1445
36 Ga0123356_10000140 3300010049 Bacteria 81836
37 Ga0123356_10001554 3300010049 Bacteria 25281
38 Ga0123356_10034264 3300010049 Bacteria 4746
39 Ga0123356_10038352 3300010049 Bacteria 4465
40 Ga0123356_10093565 3300010049 Bacteria 2869
41 Ga0123353_10000070 3300010167 Bacteria 112882
42 Ga0123353_10035498 3300010167 Bacteria 7796
43 Ga0123353_10298022 3300010167 Bacteria 2463
44 Ga0160472_100039 3300012839 Bacteria 240625
45 Ga0160448_102032 3300012854 Bacteria 6362
46 Ga0247290_00232 3300035364 Bacteria 15387
47 Ga0415639_008425 3300038395 Unclassified 7042
48 Ga0466693_227394 3300042592 Bacteria 3764
49 Ga0466704_003807 3300042643 Bacteria 58502
50 Ga0466706_010414 3300042599 Bacteria 41464
51 Ga0466706_059967 3300042599 Unclassified 8951
52 Ga0466706_118979 3300042599 Bacteria 23893
53 Ga0466706_125817 3300042599 Unclassified 24111
54 Ga0466706_143669 3300042599 Bacteria 10963
55 Ga0466706_145725 3300042599 Bacteria 1157
56 Ga0466706_249327 3300042599 Bacteria 5299
57 Ga0466706_266015 3300042599 Bacteria 9629
58 Ga0466707_034132 3300042601 Bacteria 5836
59 Ga0466707_041370 3300042601 Bacteria 14665
60 Ga0466719_435958 3300042606 Bacteria 7009
61 Ga0466722_088959 3300042609 Bacteria 4215
62 FGTW_contig00261 2065487013 Unclassified 4798
63 JGI24702J35022_10004641 3300002462 Bacteria 8133
64 JGI24703J35330_11747807 3300002501 Bacteria 8383
65 Ga0466705_200437 3300042612 Bacteria 6968
66 Ga0466733_076138 3300042659 Bacteria 1361
67 Ga0123357_10272437 3300009784 Bacteria 1766
68 Ga0123355_10004809 3300009826 Bacteria 19653
69 Ga0123355_10219888 3300009826 Bacteria 2734
70 Ga0123356_10000028 3300010049 Bacteria 164875
71 Ga0123356_10000563 3300010049 Bacteria 41227
72 Ga0123356_10003762 3300010049 Bacteria 15811
73 Ga0123356_10020007 3300010049 Bacteria 6339
74 Ga0123356_10100532 3300010049 Bacteria 2774
75 Ga0123356_10112467 3300010049 Bacteria 2633
76 Ga0123356_10293476 3300010049 Bacteria 1727
77 Ga0123353_10016412 3300010167 Bacteria 10826
78 Ga0123353_10107800 3300010167 Bacteria 4489
79 Ga0123353_10414326 3300010167 Bacteria 1999
80 Ga0123353_10683930 3300010167 Bacteria 1444
81 Ga0123353_10846434 3300010167 Bacteria 1254
82 Ga0123354_10164966 3300010882 Bacteria 2609
83 Ga0123354_10325234 3300010882 Bacteria 1411
84 Ga0160468_100392 3300012819 Bacteria 19048
85 Ga0415639_001479 3300038395 Bacteria 30213
86 Ga0415639_015998 3300038395 Bacteria 9744
87 Ga0415639_019715 3300038395 Bacteria 33688
88 Ga0415639_095742 3300038395 Unclassified 2539
89 Ga0415639_112881 3300038395 Bacteria 1988
90 Ga0466690_396157 3300042590 Bacteria 7155
91 Ga0466710_323397 3300042613 Bacteria 1749
92 Ga0466726_056794 3300042619 Bacteria 1338
93 Ga0466726_454144 3300042619 Bacteria 15087
94 Ga0466703_097450 3300042636 Bacteria 7450
95 Ga0466706_194325 3300042599 Bacteria 25350
96 Ga0466706_279475 3300042599 Bacteria 14214
97 Ga0466717_158590 3300042604 Bacteria 1052
98 Ga0466721_083956 3300042608 Bacteria 4603
99 2227302992 2225789004 Bacteria 29990
100 Ga0127657_102179 3300009457 Bacteria 33619
101 Ga0466705_315599 3300042612 Bacteria 222244
102 Ga0562375_0278 3300056856 Bacteria 131571
103 Ga0123355_10001186 3300009826 Bacteria 36226
104 Ga0123356_10001009 3300010049 Bacteria 31267
105 Ga0123356_10001947 3300010049 Bacteria 22359
106 Ga0123356_10003100 3300010049 Bacteria 17544
107 Ga0123356_10012941 3300010049 Bacteria 8077
108 Ga0123356_10027335 3300010049 Bacteria 5347
109 Ga0123356_10051701 3300010049 Bacteria 3822
110 Ga0123356_10325279 3300010049 Bacteria 1652
111 Ga0123356_10395550 3300010049 Bacteria 1518
112 Ga0123353_10006200 3300010167 Bacteria 15886
113 Ga0123353_10009025 3300010167 Bacteria 13702
114 Ga0123353_10063992 3300010167 Bacteria 5901
115 Ga0123353_10305197 3300010167 Bacteria 2426
116 Ga0123353_10344478 3300010167 Bacteria 2249
117 Ga0123353_10377216 3300010167 Bacteria 2123
118 Ga0123353_10397514 3300010167 Bacteria 2053
119 Ga0123353_10486848 3300010167 Bacteria 1803
120 Ga0123353_10581508 3300010167 Bacteria 1606
121 Ga0123353_10627844 3300010167 Bacteria 1527
122 Ga0123353_10692554 3300010167 Bacteria 1432
123 Ga0123353_11026535 3300010167 Bacteria 1105
124 Ga0123354_10056501 3300010882 Bacteria 5860
125 Ga0123354_10206853 3300010882 Unclassified 2136
126 Ga0415639_181117 3300038395 Bacteria 6049
127 Ga0466693_202455 3300042592 Bacteria 1444
128 Ga0466696_290262 3300042596 Bacteria 1527
129 Ga0466728_115190 3300042620 Unclassified 5983
130 Ga0466735_202980 3300042624 Bacteria 3674
131 Ga0466702_055832 3300042635 Bacteria 57969
132 Ga0466702_301665 3300042635 Bacteria 17686
133 Ga0466724_16785 3300042649 Bacteria 209654
134 Ga0466725_315993 3300042654 Bacteria 8684
135 Ga0466706_019104 3300042599 Bacteria 46894
136 Ga0466706_087925 3300042599 Bacteria 23424
137 Ga0466706_100462 3300042599 Bacteria 36169
138 Ga0466706_105426 3300042599 Unclassified 6186
139 Ga0466706_261318 3300042599 Bacteria 1185
140 Ga0466706_262180 3300042599 Bacteria 3126
141 Ga0466706_268276 3300042599 Bacteria 1276
142 Ga0466700_458526 3300042600 Bacteria 2752
143 Ga0466719_186658 3300042606 Bacteria 3432
144 Ga0466719_365597 3300042606 Bacteria 12234
145 Ga0466721_163952 3300042608 Bacteria 1859
146 IMNBL1DRAFT_c0010136 3300000062 Bacteria 4555
147 JGI24695J34938_10009702 3300002450 Bacteria 5335
148 JGI24703J35330_11748306 3300002501 Unclassified 13592
149 Ga0072940_1164598 3300005200 Bacteria 4624
150 Ga0105553_1043419 3300007767 Bacteria 3818
151 Ga0123355_10168220 3300009826 Bacteria 3283
152 Ga0123355_10237729 3300009826 Bacteria 2588
153 Ga0123356_10002757 3300010049 Bacteria 18666
154 Ga0123356_10004739 3300010049 Bacteria 14013
155 Ga0123356_10009479 3300010049 Bacteria 9613
156 Ga0123356_10031649 3300010049 Bacteria 4949
157 Ga0123356_10049519 3300010049 Bacteria 3911
158 Ga0123356_10116972 3300010049 Bacteria 2586
159 Ga0123356_10119858 3300010049 Bacteria 2557
160 Ga0123356_10309434 3300010049 Bacteria 1688
161 Ga0123356_10651989 3300010049 Bacteria 1220
162 Ga0123353_10128051 3300010167 Bacteria 4077
163 Ga0123353_10277731 3300010167 Bacteria 2575
164 Ga0247289_0145 3300035363 Unclassified 18609
165 Ga0247290_00144 3300035364 Unclassified 22157
166 Ga0415639_002073 3300038395 Bacteria 23347
167 Ga0415639_057403 3300038395 Bacteria 1155
168 Ga0466693_006638 3300042592 Bacteria 1925
169 Ga0466694_284825 3300042594 Bacteria 8775
170 Ga0466723_120228 3300042618 Bacteria 3439
171 Ga0466703_086607 3300042636 Bacteria 64365
172 Ga0466724_21855 3300042649 Bacteria 50243
173 Ga0466706_027139 3300042599 Bacteria 30846
174 Ga0466706_039360 3300042599 Bacteria 1781
175 Ga0466706_066788 3300042599 Bacteria 5579
176 Ga0466706_115983 3300042599 Bacteria 2303
177 Ga0466719_547663 3300042606 Bacteria 2288
178 Ga0466721_395149 3300042608 Bacteria 8359
179 AustNasuHG_c1000063 3300000089 Bacteria 29129
180 JGI24700J35501_10739375 3300002508 Bacteria 1281
181 Ga0063521_1000133 3300003973 Bacteria 55555
182 Ga0127645_101855 3300009461 Bacteria 7648
183 Ga0466705_076817 3300042612 Bacteria 4174
184 Ga0562377_0016 3300056842 Bacteria 1202354
185 Ga0123355_10003576 3300009826 Bacteria 22352
186 Ga0123355_10151644 3300009826 Bacteria 3519
187 Ga0123355_10168674 3300009826 Bacteria 3277
188 Ga0123356_10014034 3300010049 Bacteria 7708
189 Ga0123356_10015934 3300010049 Bacteria 7188
190 Ga0123356_10174387 3300010049 Bacteria 2165
191 Ga0123356_10190808 3300010049 Bacteria 2080
192 Ga0123353_10012954 3300010167 Bacteria 11909
193 Ga0123353_10089150 3300010167 Bacteria 4967
194 Ga0123353_10102004 3300010167 Bacteria 4625
195 Ga0123353_10318907 3300010167 Bacteria 2360
196 Ga0123353_10397476 3300010167 Bacteria 2053
197 Ga0123353_10417156 3300010167 Unclassified 1990
198 Ga0123353_10444360 3300010167 Unclassified 1912
199 Ga0123353_10916390 3300010167 Bacteria 1191
200 Ga0247289_0113 3300035363 Unclassified 21398
201 Ga0415639_034700 3300038395 Bacteria 6106
202 Ga0415639_089780 3300038395 Bacteria 5025
203 Ga0466693_022148 3300042592 Bacteria 1428
204 Ga0466726_060049 3300042619 Bacteria 1983
205 Ga0466726_489034 3300042619 Bacteria 3403
206 Ga0466702_051630 3300042635 Bacteria 1942
207 Ga0466725_386944 3300042654 Bacteria 1898
208 Ga0466706_053260 3300042599 Bacteria 6152
209 Ga0466706_131044 3300042599 Bacteria 5569
210 Ga0466706_178381 3300042599 Bacteria 3276
211 Ga0466706_239280 3300042599 Bacteria 9844
212 Ga0466706_243565 3300042599 Bacteria 1975
213 Ga0466706_280862 3300042599 Unclassified 3184
214 Ga0466707_174331 3300042601 Bacteria 19366
215 Ga0466707_350890 3300042601 Bacteria 2857
216 Ga0466716_183620 3300042605 Bacteria 3137
217 JGI24703J35330_11748584 3300002501 Bacteria 21053
218 Ga0072940_1285897 3300005200 Bacteria 5859
219 Ga0074188_1000287 3300005318 Bacteria 18151
220 Ga0105553_1033961 3300007767 Bacteria 34168
221 Ga0562375_0562 3300056856 Bacteria 73581
222 Ga0123357_10071777 3300009784 Bacteria 4590
223 Ga0123357_10388617 3300009784 Bacteria 1285
224 Ga0123355_10000483 3300009826 Bacteria 52795
225 Ga0123355_10168186 3300009826 Bacteria 3284
226 Ga0123356_10000889 3300010049 Bacteria 33059
227 Ga0123356_10010809 3300010049 Bacteria 8927
228 Ga0123356_10014354 3300010049 Bacteria 7618
229 Ga0123356_10046600 3300010049 Bacteria 4034
230 Ga0123356_10127247 3300010049 Bacteria 2489
231 Ga0123356_10177514 3300010049 Bacteria 2148
232 Ga0123356_10338939 3300010049 Bacteria 1623
233 Ga0123353_10014363 3300010167 Bacteria 11407
234 Ga0123353_10026407 3300010167 Bacteria 8869
235 Ga0123353_10161719 3300010167 Bacteria 3564
236 Ga0123353_10164263 3300010167 Bacteria 3531
237 Ga0123353_10170008 3300010167 Bacteria 3461
238 Ga0160433_102225 3300012846 Bacteria 4335
239 Ga0415639_007305 3300038395 Bacteria 17528
240 Ga0415639_008423 3300038395 Bacteria 4594
241 Ga0466692_149613 3300042591 Bacteria 5991
242 Ga0466726_427031 3300042619 Bacteria 3982
243 Ga0466704_404275 3300042643 Bacteria 6275
244 Ga0466708_423478 3300042652 Bacteria 8742
245 Ga0466727_337993 3300042655 Bacteria 6655
246 Ga0466706_055567 3300042599 Bacteria 3106
247 Ga0466706_195314 3300042599 Bacteria 44668
248 Ga0466706_195848 3300042599 Unclassified 10538
249 Ga0466706_195938 3300042599 Bacteria 24984
250 Ga0466707_035305 3300042601 Bacteria 25399
251 Ga0466707_086118 3300042601 Bacteria 94741
252 IMNBL1DRAFT_c0034935 3300000062 Bacteria 1780
253 JGI24695J34938_10001118 3300002450 Bacteria 24171
254 JGI24695J34938_10054485 3300002450 Bacteria 1734
255 Ga0072940_1048060 3300005200 Unclassified 3512
256 Ga0466705_370668 3300042612 Bacteria 4167
257 Ga0123355_10000753 3300009826 Bacteria 44251
258 Ga0123355_10020416 3300009826 Bacteria 10578
259 Ga0123355_10030517 3300009826 Bacteria 8735
260 Ga0123356_10000491 3300010049 Bacteria 44039
261 Ga0123356_10010202 3300010049 Bacteria 9238
262 Ga0123356_10064243 3300010049 Bacteria 3431
263 Ga0123356_10237488 3300010049 Bacteria 1891
264 Ga0123353_10096436 3300010167 Bacteria 4766
265 Ga0123353_10124989 3300010167 Bacteria 4134
266 Ga0123353_10397276 3300010167 Bacteria 2054
267 Ga0123353_10504343 3300010167 Bacteria 1762
268 Ga0160433_100798 3300012846 Bacteria 11341
269 Ga0415639_022043 3300038395 Bacteria 30115
270 Ga0415639_027091 3300038395 Bacteria 3190
271 Ga0415639_063903 3300038395 Bacteria 1579
272 Ga0466705_505683 3300042612 Bacteria 150209
273 Ga0466710_160524 3300042613 Bacteria 35106
274 Ga0466703_184521 3300042636 Bacteria 7732
275 Ga0466706_162053 3300042599 Bacteria 30018
276 Ga0466707_031382 3300042601 Bacteria 23032
277 Ga0466707_353968 3300042601 Bacteria 4357
278 Ga0466714_020685 3300042603 Bacteria 3141
279 DPOL_contig15172 2035918003 Bacteria 24635
280 JGI24702J35022_10000388 3300002462 Bacteria 26188
281 JGI24705J35276_12234603 3300002504 Bacteria 5664
282 Ga0068305_10011964 3300005083 Bacteria 124405

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y) 5 320 0.93

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.