Protein Family IF04333

Metagenome Isolate
153 Members
75 Samples
117 Scaffolds
276.93 Avg Length

🧬 Representative Sequence

ID
3300038395|Ga0415639_171127|Ga0415639_171127_6744_7685
Length
313 aa
Sequence
MLYTRRRRTHQIFREFFRTKNSKKGEDYMLKEIMARKKQDITDSRATTGKKGEVKVDIPADMFVKCTDCGRSIYRKEMQSLHNSCPNCNKLFRLSAKARVDLVTDEGSFQELDIKVERKNPLNFPEYDAKLDKAEKASGLKEAVLCGECKIEGSRAIICVMDSHFMMGSMGSAVGEYLATAFEVATARRLPIVIFTASGGARMQEGIVSLMQMAKVSGALAAHSEEGLLYITVLTDPTTGGVTASFASLGDIILAEKGALIGFAGRRVIEQTIRQKLPSDFQSAEFLLEKGFVDAIVDRSNQKEVIGKILSMH

📊 Sample Types

Isolate 23.5%
Metagenome 76.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 19.2%
Termitidae 17.8%
Unclassified 15.1%
Pyralidae 6.8%
Elmidae 5.5%
Termopsidae 5.5%
Rhinotermitidae 4.1%
Scarabaeidae 4.1%
Bombycidae 2.7%
Tenebrionidae 2.7%
Portunidae 1.4%
Drosophilidae 1.4%
Ocypodidae 1.4%
Gomphidae 1.4%
Nephropidae 1.4%
Hydrophilidae 1.4%
Noctuidae 1.4%
Eresidae 1.4%
Culicidae 1.4%
Hodotermitidae 1.4%
Passalidae 1.4%
Curculionidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 143
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2585428141 Pilibacter termitis ATCC BAA-1030 Isolate Rhinotermitidae
2 2820075487 Unclassified Proteobacteria Nt197P3bin122 Isolate Unclassified
3 2820261600 Unclassified Firmicutes Th196P3bin40 Isolate Unclassified
4 2969145278 Bacillus cereus 29 Isolate Portunidae
5 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
6 642555172 Endomicrobium trichonymphae Rs-D17 Isolate Unclassified
7 643886087 Bacillus thuringiensis sv. kurstaki T03a001 Isolate Pyralidae
8 643886090 Bacillus thuringiensis sv. pakistani t13001 Isolate Unclassified
9 8061100935 Bacillus thuringiensis sv. japonensis 62 Isolate
10 2822450720 Bacillus toyonensis AFS052650 Isolate Scarabaeidae
11 2864782175 Bacillus toyonensis S00025 Isolate Elmidae
12 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
13 2978778678 Bacillus cereus 25 Isolate Ocypodidae
14 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
15 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
16 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
17 8018802046 Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 Isolate Gomphidae
18 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
19 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
20 2864895409 Bacillus aerius S00152 Isolate Elmidae
21 2873581347 Vagococcus hydrophili HDW17B Isolate Hydrophilidae
22 2563367190 Bacillus thuringiensis sv. aizawai Leapi01 Isolate Noctuidae
23 2791355481 Bacillus sp. ZY-1-1 Isolate Scarabaeidae
24 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
25 8022725327 Bacillus sp. SN10 Isolate Eresidae
26 8022781829 Bacillus sp. VKPM B-3276 Isolate Culicidae
27 8064531044 Terrisporobacter mayombei DSM 6539 Isolate Unclassified
28 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
29 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
30 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
31 2537562000 Bacillus cereus HD73 Isolate Pyralidae
32 2574180310 Bacillus licheniformis CG-B52 Isolate Unclassified
33 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
34 8061045771 Bacillus thuringiensis sv. kurstaki BGSC 4D1 Isolate Bombycidae
35 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
36 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
37 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
38 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
39 2912849059 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
40 2209111004 Macrotermes natalensis queen gut microbiome Metagenome Termitidae
41 2590828839 Clostridium sp. 1 Isolate Termitidae
42 2820721785 Unclassified Fibrobacteres Lab288P1bin58 Isolate Unclassified
43 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
44 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
45 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
46 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
47 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
48 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
49 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
50 2822232166 Bacillus toyonensis AFS084242 Isolate Scarabaeidae
51 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
52 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
53 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
54 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
55 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
56 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
57 2864909992 Bacillus velezensis S00166 Isolate Elmidae
58 2820046858 Unclassified Proteobacteria Th196P3bin84 Isolate Unclassified
59 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
60 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
61 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
62 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
63 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
64 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
65 8018798118 Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 Isolate
66 8061039349 Bacillus thuringiensis sv. galleriae BGSC 4G4 Isolate Bombycidae
67 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
68 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
69 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
70 2864801025 Bacillus aerius S00042 Isolate Elmidae
71 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
72 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
73 643886085 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
74 643886091 Bacillus thuringiensis sv. thuringiensis T01001 Isolate Pyralidae
75 8012942269 Mammaliicoccus lentus UD i2 Isolate Tenebrionidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_202131 3300042659 Bacteria 1435
2 Ga0123356_10050609 3300010049 Bacteria 3865
3 Ga0123353_10041769 3300010167 Bacteria 7249
4 Ga0466735_033290 3300042624 Bacteria 13180
5 Ga0466704_364740 3300042643 Unclassified 57997
6 Ga0466708_007154 3300042652 Bacteria 5661
7 Ga0466706_019380 3300042599 Bacteria 325727
8 Ga0466706_174674 3300042599 Bacteria 11411
9 Ga0466707_410434 3300042601 Bacteria 14526
10 Ga0466719_421316 3300042606 Bacteria 10005
11 Ga0466722_182394 3300042609 Bacteria 2438
12 Ga0068305_10000253 3300005083 Bacteria 49207
13 Ga0466711_117944 3300042615 Bacteria 215972
14 Ga0466711_228583 3300042615 Bacteria 4031
15 Ga0466723_260843 3300042618 Unclassified 28535
16 Ga0466726_158471 3300042619 Bacteria 35402
17 Ga0466726_378994 3300042619 Bacteria 129768
18 Ga0466728_329025 3300042620 Bacteria 9692
19 Ga0123357_10003787 3300009784 Bacteria 17500
20 Ga0123357_10241696 3300009784 Bacteria 1953
21 Ga0466735_118830 3300042624 Bacteria 14931
22 Ga0466735_122109 3300042624 Bacteria 4311
23 Ga0466727_117004 3300042655 Bacteria 1167
24 Ga0466706_010259 3300042599 Bacteria 63363
25 Ga0466706_183178 3300042599 Bacteria 15497
26 Ga0466719_075170 3300042606 Bacteria 3615
27 Ga0466715_112554 3300042616 Bacteria 31031
28 Ga0466728_410586 3300042620 Bacteria 34706
29 Ga0466690_048357 3300042590 Bacteria 10256
30 Ga0466705_321631 3300042612 Bacteria 270475
31 Ga0123355_10371202 3300009826 Unclassified 1874
32 Ga0123353_10281312 3300010167 Bacteria 2555
33 Ga0123353_10312745 3300010167 Unclassified 2389
34 Ga0466735_050144 3300042624 Bacteria 25386
35 Ga0466735_072616 3300042624 Bacteria 10087
36 Ga0466735_130546 3300042624 Bacteria 11044
37 Ga0466735_166143 3300042624 Bacteria 3663
38 Ga0466730_059705 3300042625 Unclassified 1406
39 Ga0466727_077915 3300042655 Bacteria 1804
40 Ga0466706_121376 3300042599 Bacteria 9389
41 Ga0466707_406882 3300042601 Bacteria 34507
42 Ga0068305_10000195 3300005083 Bacteria 118813
43 Ga0466715_028990 3300042616 Bacteria 46691
44 Ga0466723_373944 3300042618 Unclassified 28303
45 Ga0466726_152326 3300042619 Bacteria 13437
46 Ga0415639_013994 3300038395 Bacteria 2328
47 Ga0466691_107875 3300042593 Bacteria 13249
48 Ga0466704_270701 3300042643 Bacteria 11717
49 Ga0466706_006636 3300042599 Bacteria 217881
50 Ga0466707_158829 3300042601 Bacteria 178149
51 Ga0466707_288884 3300042601 Bacteria 5359
52 Ga0466713_005286 3300042602 Bacteria 50542
53 IMNBL1DRAFT_c0004552 3300000062 Bacteria 8278
54 Ga0466726_071206 3300042619 Bacteria 1197
55 Ga0466728_437045 3300042620 Bacteria 11081
56 Ga0466729_016754 3300042621 Bacteria 37408
57 Ga0466690_243346 3300042590 Bacteria 1480
58 Ga0466691_076994 3300042593 Bacteria 7333
59 Ga0466733_201569 3300042659 Bacteria 4515
60 Ga0562379_0003 3300056790 Bacteria 3011780
61 Ga0123355_10669986 3300009826 Bacteria 1203
62 Ga0466735_029557 3300042624 Bacteria 17303
63 Ga0466730_083014 3300042625 Bacteria 4219
64 Ga0466704_582126 3300042643 Bacteria 7730
65 Ga0466727_151432 3300042655 Bacteria 242508
66 Ga0466700_093272 3300042600 Bacteria 1080
67 Ga0466716_305704 3300042605 Bacteria 9495
68 Ga0063521_1000278 3300003973 Unclassified 32708
69 Ga0466715_372841 3300042616 Bacteria 11287
70 Ga0466728_066684 3300042620 Bacteria 35223
71 Ga0466729_101185 3300042621 Bacteria 22730
72 Ga0466691_225685 3300042593 Bacteria 109994
73 Ga0466696_331233 3300042596 Bacteria 2942
74 Ga0123355_10194147 3300009826 Bacteria 2981
75 Ga0123355_10330058 3300009826 Bacteria 2045
76 Ga0466735_004060 3300042624 Bacteria 13967
77 Ga0466735_166239 3300042624 Unclassified 1732
78 Ga0466735_175982 3300042624 Bacteria 10392
79 Ga0466709_368785 3300042648 Bacteria 33804
80 Ga0466724_06301 3300042649 Bacteria 2830
81 Ga0466719_442134 3300042606 Bacteria 13292
82 Ga0466705_392935 3300042612 Bacteria 18153
83 Ga0466726_022795 3300042619 Bacteria 6027
84 Ga0415639_208632 3300038395 Bacteria 1951
85 Ga0466690_355270 3300042590 Bacteria 9568
86 Ga0123356_10101250 3300010049 Bacteria 2764
87 Ga0466735_128854 3300042624 Bacteria 31221
88 Ga0466735_229643 3300042624 Unclassified 5306
89 Ga0466703_046544 3300042636 Bacteria 38951
90 Ga0466703_244879 3300042636 Bacteria 60768
91 Ga0466708_211014 3300042652 Bacteria 28441
92 Ga0466708_254181 3300042652 Bacteria 6707
93 Ga0466713_044417 3300042602 Bacteria 52236
94 Ga0068302_10396413 3300005071 Unclassified 3815
95 Ga0466726_009564 3300042619 Bacteria 101360
96 Ga0466726_072424 3300042619 Bacteria 11909
97 Ga0466726_370296 3300042619 Bacteria 3590
98 Ga0466728_205591 3300042620 Bacteria 48931
99 Ga0466728_374130 3300042620 Bacteria 101360
100 Ga0466729_069876 3300042621 Bacteria 5687
101 Ga0415639_073670 3300038395 Bacteria 1487
102 Ga0415639_171127 3300038395 Bacteria 9672
103 Ga0466696_178183 3300042596 Bacteria 12729
104 Ga0123355_10570883 3300009826 Bacteria 1357
105 Ga0123353_10010830 3300010167 Bacteria 12765
106 Ga0466702_450433 3300042635 Bacteria 2521
107 Ga0466704_570609 3300042643 Bacteria 26629
108 Ga0466725_437607 3300042654 Bacteria 1721
109 Ga0466706_271952 3300042599 Bacteria 8558
110 Ga0466707_312703 3300042601 Bacteria 49252
111 Ga0466707_416679 3300042601 Bacteria 126598
112 2211830539 2209111004 Bacteria 32177
113 Ga0068302_10128122 3300005071 Bacteria 4159
114 Ga0068305_10000187 3300005083 Bacteria 96943
115 Ga0466723_192931 3300042618 Bacteria 2183
116 Ga0466726_165557 3300042619 Bacteria 12979
117 Ga0415639_052828 3300038395 Bacteria 3230

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01039 Carboxyl_trans Carboxyl transferase domain 96 273 0.83

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.