Protein Family IF04316

Metagenome Isolate
130 Members
51 Samples
106 Scaffolds
297.69 Avg Length

🧬 Representative Sequence

ID
3300038395|Ga0415639_076702|Ga0415639_076702_8943_9938
Length
331 aa
Sequence
MPSFGRRRNRVRFSLQLCLKNAGFSYNGCCILHLKGGILVDFLKRMTEVIDYIEDNITEEIDFNDVSKIACCGVYQFGRIFSYVVGVSFAEYIRNRRLSLAALELQANGIKVIDTALKFGYQSPDSFTRAFREMHGVSPTEARSKSVTLKMFPRISFQISIKGAVEMDYRIETKDAITCVGRTYRQTKEQVKGGEGFATSWGLYLDTKDESLGKTPNEAIRDDYKLYRAPMWQVGMSHVLDDGNFEMSIGAQADGGNYPGFVFFEIPAGQWAKFIAKEKSLDELYTKIFSEWLPSSGYEHAMQYTVEIYHMDATNKGNDFTFEIWIPVRKM

📊 Sample Types

Isolate 18.5%
Metagenome 81.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 47.1%
Termitidae 39.2%
Kalotermitidae 5.9%
Rhinotermitidae 2.0%
Hodotermitidae 2.0%
Passalidae 2.0%
Termopsidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 119
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820520043 Unclassified Firmicutes Lab288P1bin24 Isolate Unclassified
2 2820636287 Unclassified Firmicutes Emb289P1bin112 Isolate Unclassified
3 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
4 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
5 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
6 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
7 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
8 2820541116 Unclassified Firmicutes Lab288P1bin109 Isolate Unclassified
9 2820596822 Unclassified Firmicutes Emb289P1bin58 Isolate Unclassified
10 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
11 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
12 2820378768 Unclassified Firmicutes Nt197P1bin7 Isolate Unclassified
13 2820382897 Unclassified Firmicutes Nt197P1bin3 Isolate Unclassified
14 2820627938 Unclassified Firmicutes Emb289P1bin122 Isolate Unclassified
15 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
16 2820375548 Unclassified Firmicutes Nt197P1bin8 Isolate Unclassified
17 2820408893 Unclassified Firmicutes Lab288P4bin80 Isolate Unclassified
18 2820587002 Unclassified Firmicutes Emb289P1bin94 Isolate Unclassified
19 2820615445 Unclassified Firmicutes Emb289P1bin132 Isolate Unclassified
20 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
21 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
22 2820435670 Unclassified Firmicutes Lab288P3bin217 Isolate Unclassified
23 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
24 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
25 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
26 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
27 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
28 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
29 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
30 2820418027 Unclassified Firmicutes Lab288P3bin85 Isolate Unclassified
31 2820630457 Unclassified Firmicutes Emb289P1bin119 Isolate Unclassified
32 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
33 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
34 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
35 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
36 2820537337 Unclassified Firmicutes Lab288P1bin137 Isolate Unclassified
37 2820623020 Unclassified Firmicutes Emb289P1bin126 Isolate Unclassified
38 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
39 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
40 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
41 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
42 2820414148 Unclassified Firmicutes Lab288P3bin93 Isolate Unclassified
43 2820432912 Unclassified Firmicutes Lab288P3bin219 Isolate Unclassified
44 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
45 2820566695 Unclassified Firmicutes Emb289P3bin50 Isolate Unclassified
46 2820600392 Unclassified Firmicutes Emb289P1bin52 Isolate Unclassified
47 2820607737 Unclassified Firmicutes Emb289P1bin48 Isolate Unclassified
48 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
49 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
50 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
51 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_190342 3300042611 Bacteria 1278
2 Ga0466732_306084 3300042656 Bacteria 2204
3 Ga0415639_076702 3300038395 Bacteria 10902
4 Ga0415639_112853 3300038395 Bacteria 3026
5 Ga0415639_187854 3300038395 Bacteria 1338
6 Ga0466717_282149 3300042604 Bacteria 3221
7 Ga0466719_421688 3300042606 Bacteria 3092
8 Ga0466721_175332 3300042608 Bacteria 2027
9 Ga0123355_10000216 3300009826 Bacteria 72252
10 Ga0123355_10000889 3300009826 Unclassified 41392
11 Ga0123355_10002796 3300009826 Bacteria 24770
12 Ga0123355_10009140 3300009826 Bacteria 15033
13 Ga0123355_10009949 3300009826 Bacteria 14516
14 Ga0123355_10024460 3300009826 Bacteria 9709
15 Ga0123355_10028968 3300009826 Bacteria 8958
16 Ga0123355_10222615 3300009826 Bacteria 2710
17 Ga0123353_10000037 3300010167 Bacteria 145591
18 Ga0466733_178486 3300042659 Bacteria 2269
19 JGI24695J34938_10000384 3300002450 Bacteria 43800
20 Ga0466693_134517 3300042592 Bacteria 2180
21 Ga0466721_075996 3300042608 Bacteria 2661
22 Ga0466734_042348 3300042623 Bacteria 1190
23 Ga0123355_10009027 3300009826 Bacteria 15111
24 Ga0123355_10033351 3300009826 Bacteria 8364
25 Ga0123355_10050563 3300009826 Unclassified 6750
26 Ga0123355_10424493 3300009826 Bacteria 1696
27 Ga0123355_10488066 3300009826 Bacteria 1528
28 Ga0123356_10043231 3300010049 Bacteria 4195
29 Ga0123353_10255200 3300010167 Bacteria 2712
30 Ga0123353_10551297 3300010167 Bacteria 1663
31 Ga0466732_373878 3300042656 Bacteria 1298
32 IMNBL1DRAFT_c0005961 3300000062 Bacteria 6813
33 JGI24703J35330_11748873 3300002501 Bacteria 177009
34 Ga0415639_015623 3300038395 Bacteria 5220
35 Ga0466734_076001 3300042623 Bacteria 2240
36 Ga0123355_10013850 3300009826 Bacteria 12573
37 Ga0123355_10103273 3300009826 Bacteria 4481
38 Ga0123356_10091396 3300010049 Bacteria 2901
39 Ga0123356_10198611 3300010049 Bacteria 2043
40 JGI24703J35330_11468561 3300002501 Unclassified 1060
41 Ga0466693_211054 3300042592 Bacteria 3418
42 Ga0466699_391449 3300042597 Bacteria 1365
43 Ga0466707_349774 3300042601 Bacteria 13164
44 Ga0466721_231448 3300042608 Bacteria 2218
45 Ga0466704_348842 3300042643 Bacteria 2688
46 Ga0123355_10000967 3300009826 Bacteria 39727
47 Ga0123355_10022535 3300009826 Bacteria 10096
48 Ga0123355_10044051 3300009826 Bacteria 7261
49 Ga0123355_10243015 3300009826 Bacteria 2547
50 Ga0123356_10119173 3300010049 Bacteria 2563
51 Ga0123353_10006916 3300010167 Bacteria 15241
52 Ga0466733_190182 3300042659 Bacteria 3165
53 IMNBL1DRAFT_c0002701 3300000062 Bacteria 12093
54 JGI24703J35330_11743553 3300002501 Bacteria 3930
55 Ga0466706_175868 3300042599 Unclassified 3332
56 Ga0466724_64640 3300042649 Bacteria 1500
57 Ga0123355_10000113 3300009826 Bacteria 90973
58 Ga0123355_10000586 3300009826 Bacteria 49066
59 Ga0123355_10003473 3300009826 Unclassified 22594
60 Ga0123356_10001003 3300010049 Unclassified 31354
61 Ga0123356_10353941 3300010049 Bacteria 1593
62 Ga0123353_10059187 3300010167 Bacteria 6142
63 Ga0123353_10402978 3300010167 Bacteria 2035
64 IMNBL1DRAFT_c0000973 3300000062 Bacteria 22104
65 JGI24695J34938_10045147 3300002450 Bacteria 1956
66 JGI24695J34938_10045415 3300002450 Bacteria 1949
67 Ga0123357_10000855 3300009784 Bacteria 31004
68 Ga0466656_372898 3300042550 Bacteria 1151
69 Ga0466721_111570 3300042608 Bacteria 2598
70 Ga0123355_10001544 3300009826 Bacteria 32121
71 Ga0123355_10014240 3300009826 Bacteria 12426
72 Ga0123355_10030460 3300009826 Bacteria 8744
73 Ga0123355_10082889 3300009826 Bacteria 5113
74 Ga0123355_10118611 3300009826 Bacteria 4111
75 Ga0123356_10002434 3300010049 Bacteria 19908
76 Ga0123356_10338322 3300010049 Unclassified 1624
77 Ga0123353_10318966 3300010167 Bacteria 2360
78 Ga0123354_10123515 3300010882 Bacteria 3324
79 JGI24695J34938_10042014 3300002450 Unclassified 2049
80 Ga0415639_033795 3300038395 Unclassified 3985
81 Ga0466693_311315 3300042592 Unclassified 1357
82 Ga0466699_170459 3300042597 Bacteria 2117
83 Ga0466707_161620 3300042601 Bacteria 3459
84 Ga0466722_000118 3300042609 Bacteria 2057
85 Ga0123355_10000313 3300009826 Bacteria 62382
86 Ga0123355_10002444 3300009826 Bacteria 26254
87 Ga0123355_10003219 3300009826 Bacteria 23330
88 Ga0123355_10023680 3300009826 Bacteria 9863
89 Ga0123355_10052902 3300009826 Unclassified 6586
90 Ga0123355_10061261 3300009826 Bacteria 6076
91 Ga0123355_10073273 3300009826 Bacteria 5489
92 Ga0123356_10094909 3300010049 Bacteria 2850
93 Ga0123356_10555655 3300010049 Bacteria 1309
94 Ga0123356_11046205 3300010049 Bacteria 986
95 Ga0466700_316710 3300042600 Bacteria 3321
96 Ga0466731_152830 3300042622 Bacteria 3539
97 Ga0466735_007207 3300042624 Bacteria 1548
98 Ga0123355_10011082 3300009826 Bacteria 13881
99 Ga0123355_10285896 3300009826 Bacteria 2270
100 Ga0123355_10392384 3300009826 Bacteria 1798
101 Ga0123356_10239329 3300010049 Bacteria 1885
102 Ga0123356_10934593 3300010049 Bacteria 1038
103 Ga0123353_10000127 3300010167 Bacteria 91557
104 Ga0123353_10000174 3300010167 Bacteria 81672
105 Ga0123353_10057779 3300010167 Bacteria 6215
106 Ga0466705_429542 3300042612 Bacteria 13402

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF12833 HTH_18 Helix-turn-helix domain 67 144 0.96
PF14526 Cass2 Integron-associated effector binding protein 170 328 0.92
PF06445 GyrI-like GyrI-like small molecule binding domain 241 329 0.9

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.