Protein Family IF04209

Metagenome Isolate
193 Members
139 Samples
98 Scaffolds
339.15 Avg Length

🧬 Representative Sequence

ID
3300026558|Ga0255576_1000002|Ga0255576_100000245
Length
335 aa
Sequence
LERVQSAEFLAEDAAELSLRPEQLSQYIGQSKVKENMRVFIAAAKKRQEAIDHILLYGPPGLGKTTLANIIAHELGVNIKHTSGPALERSGDLAAILSALEPGDVLFIDEIHRLSRSIEEILYSAMEDYCLDIILGKEASARSMRIDLPPFTLIGATTRVGDLSAPLRDRFGVHAHLEYYTQADLYEIVKRTSAVFQIEIDEQAAKELASRSRGTPRIANRLFRRIRDFAQVLDDASFISLAMTQEALGRLDIDASGLDAVDHKILRGIAERFNGGPVGLEALAASIAEEAQTLEDVYEPFLLQEGFIVRTPRGRILSAKAYAHLGIAHQGTLEE

📊 Sample Types

Isolate 49.2%
Metagenome 50.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 35.0%
Apidae 16.1%
Termitidae 10.9%
Scarabaeidae 5.1%
Blattidae 4.4%
Kalotermitidae 4.4%
Formicidae 4.4%
Tenebrionidae 3.6%
Hydrophilidae 2.9%
Termopsidae 2.9%
Elmidae 2.2%
Dytiscidae 1.5%
Drosophilidae 1.5%
Passalidae 1.5%
Halictidae 0.7%
Nephropidae 0.7%
Hodotermitidae 0.7%
Rhaphidophoridae 0.7%
Euphausiidae 0.7%

🌳 Taxonomy

Archaea 0
Bacteria 180
Eukaryota 0
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2850695442 Lactococcus allomyrinae 1JSPR-7 Isolate Scarabaeidae
2 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
3 2881902429 Companilactobacillus metriopterae JCM 31635 Isolate Unclassified
4 2905310146 Ligilactobacillus salivarius A3iob Isolate Apidae
5 2940343849 Breznakia sp. PH5-24 Isolate Blattidae
6 2961465228 Lactobacillus sp. ESL0233 Isolate Apidae
7 2684622911 Lactobacillus kullabergensis Lb_186 Isolate Unclassified
8 2684622914 Lactobacillus helsinborgensis Lb_183 Isolate Unclassified
9 2758568512 Lactobacillus helsingborgensis ESL0262 Isolate Unclassified
10 2820512088 Unclassified Firmicutes Lab288P1bin4 Isolate Unclassified
11 2820533259 Unclassified Firmicutes Lab288P1bin140 Isolate Unclassified
12 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
13 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
14 2968368220 Lactobacillus bombicola OCC3 Isolate Apidae
15 2971062614 Lactobacillus bombicola BI-4G Isolate Apidae
16 3004719924 Lactobacillus sp. W8174 Isolate Apidae
17 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
18 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
19 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
20 8001918023 Bombilactobacillus bombi XV6 Isolate Apidae
21 8002304686 Apilactobacillus kunkeei UASWS1867-NN5 Isolate Apidae
22 8007215774 Enterococcus sp. BWR-S5 Isolate Scarabaeidae
23 8017458139 Lactobacillus johnsonii CRL1647 Isolate Apidae
24 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
25 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
26 2822450720 Bacillus toyonensis AFS052650 Isolate Scarabaeidae
27 2873584433 Vagococcus coleopterorum HDW17A Isolate Dytiscidae
28 2878857142 Lactococcus lactis DmW198 Isolate Drosophilidae
29 2936628749 Apilactobacillus quenuiae HV_6 Isolate Halictidae
30 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
31 2758568514 Lactobacillus kullabergensis ESL0261 Isolate Unclassified
32 2820053807 Unclassified Proteobacteria Th196P3bin117 Isolate Unclassified
33 2820516196 Unclassified Firmicutes Lab288P1bin3 Isolate Unclassified
34 2645727721 Lactobacillus helsingborgensis Bma5 Isolate Unclassified
35 2997944163 Streptococcus penaeicida CAIM 1838 Isolate Unclassified
36 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
37 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
38 2979949929 Lactobacillus sp. ESL0263 Isolate Apidae
39 3300007901 Neotropical army ants gut microbial communities from Monteverde, Costa Rica - Eciton burchellii Gut microbial communities of Eciton burchellii Metagenome Formicidae
40 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
41 8017536074 Lactobacillus sp. ESL0261 Isolate Apidae
42 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
43 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
44 8114544644 Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 Isolate
45 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
46 2940236825 Breznakia sp. PM6-1 Isolate Blattidae
47 2940341480 Breznakia sp. PFB2-8 Isolate Blattidae
48 2851410423 Lactobacillus helsingborgensis ESL0183 Isolate Apidae
49 2209111004 Macrotermes natalensis queen gut microbiome Metagenome Termitidae
50 2758568501 Lactobacillus bombicola ESL0228 Isolate Unclassified
51 2758568502 Lactobacillus bombicola ESL0247 Isolate Unclassified
52 2758568503 Lactobacillus bombicola ESL0246 Isolate Unclassified
53 2758568511 Lactobacillus apis ESL0263 Isolate Unclassified
54 2808606958 Lactobacillus sp. ESL0449 v2 Isolate Unclassified
55 2820275298 Unclassified Firmicutes Th196P3bin17 Isolate Unclassified
56 2820447167 Unclassified Firmicutes Lab288P3bin192 Isolate Unclassified
57 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
58 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
59 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
60 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
61 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
62 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
63 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
64 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
65 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
66 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
67 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
68 2882334426 Lactobacillus sp. 2-3 Isolate Unclassified
69 2896402965 Weissella diestrammenae KACC 16890 Isolate Rhaphidophoridae
70 2758568510 Lactobacillus bombicola ESL0233 Isolate Unclassified
71 2758568557 Bombilactobacillus mellis ESL0394 Isolate Unclassified
72 2758568559 Bombilactobacillus mellis ESL0295 Isolate Unclassified
73 2820134530 Unclassified Proteobacteria Emb289P3bin65 Isolate Unclassified
74 2820393573 Unclassified Firmicutes Nc150P1bin9 Isolate Unclassified
75 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
76 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
77 3300026175 Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 Metagenome Formicidae
78 3300026559 Army ant gut microbial communities from Eciton burchelli, Santa Rosa, Costa Rica - colony SREbp2 Metagenome Formicidae
79 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
80 8002519755 Planococcus sp. MSAK28401 Isolate Euphausiidae
81 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
82 2864981449 Sporosarcina sp. S00266 Isolate Elmidae
83 2940339133 Breznakia sp. PF5-3 Isolate Blattidae
84 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
85 2758568504 Lactobacillus bombicola ESL0245 Isolate Unclassified
86 2758568515 Lactobacillus melliventris ESL0259 Isolate Unclassified
87 2758568561 Bombilactobacillus mellis ESL0292 Isolate Unclassified
88 2820261600 Unclassified Firmicutes Th196P3bin40 Isolate Unclassified
89 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
90 8064008355 Heyndrickxia oleronia Isolate Unclassified
91 2834951433 Brochothrix thermosphacta CD 337 Isolate Unclassified
92 2864895409 Bacillus aerius S00152 Isolate Elmidae
93 2873581347 Vagococcus hydrophili HDW17B Isolate Hydrophilidae
94 2916858470 Heyndrickxia oleronia Isolate Unclassified
95 2912324399 Lactobacillus apis ESL0185 Isolate Apidae
96 2820301196 Unclassified Firmicutes Th196P1bin8 Isolate Unclassified
97 2820342392 Unclassified Firmicutes Nt197P3bin64 Isolate Unclassified
98 2558860143 Apilactobacillus kunkeei EFB6 Isolate Apidae
99 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
100 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
101 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
102 2864801025 Bacillus aerius S00042 Isolate Elmidae
103 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
104 2873632256 Weissella coleopterorum HDW19 Isolate Dytiscidae
105 2877522083 Apilactobacillus bombintestini BHWM-4 Isolate Apidae
106 2684622912 Lactobacillus apis Lb_185 Isolate Unclassified
107 2684622913 Lactobacillus melliventris Lb_184 Isolate Unclassified
108 2758568513 Lactobacillus melliventris ESL0260 Isolate Unclassified
109 2758568558 Lactobacillus melliventris ESL0393 Isolate Unclassified
110 2799112220 Lactobacillus sp. ESL0411 Isolate Unclassified
111 2820236043 Unclassified Firmicutes Th196P3bin97 Isolate Unclassified
112 2814123166 Lactobacillus apis LMG 26964 Isolate Apidae
113 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
114 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
115 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
116 3300026558 Army ant gut microbial communities from Labidus praedator, Monteverde, Costa Rica - colony MVLprae1 Metagenome Formicidae
117 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
118 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
119 2822232166 Bacillus toyonensis AFS084242 Isolate Scarabaeidae
120 2873595552 Erysipelothrix sp. HDW6C Isolate Hydrophilidae
121 2877513988 Lactobacillus kullabergensis ESL0186 Isolate Apidae
122 2961515617 Lactobacillus sp. ESL0259 Isolate Apidae
123 2524614537 Lysinibacillus sphaericus OT4b.31 Isolate Unclassified
124 2675903377 Apilactobacillus kunkeei AR114 Isolate Unclassified
125 2758568560 Bombilactobacillus mellis ESL0294 Isolate Unclassified
126 2799112229 Lactobacillus sp. ESL0413 Isolate Unclassified
127 2799112230 Lactobacillus sp. ESL0416 Isolate Unclassified
128 2820418027 Unclassified Firmicutes Lab288P3bin85 Isolate Unclassified
129 2785510748 Lactobacillus sp. ESL0409 Isolate Apidae
130 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
131 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
132 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
133 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
134 8007220153 Enterococcus sp. BWB1-3 Isolate Scarabaeidae
135 8017440191 Lactobacillus bombicola L5-31 Isolate Apidae
136 8017462664 Lactobacillus melliventris ESL0184 Isolate Apidae
137 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
138 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
139 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562377_0106 3300056842 Bacteria 268063
2 Ga0562377_0245 3300056842 Bacteria 125870
3 Ga0562374_0137 3300057007 Bacteria 181544
4 Ga0415639_014375 3300038395 Bacteria 22423
5 Ga0415639_028151 3300038395 Bacteria 9340
6 Ga0123355_10078103 3300009826 Bacteria 5289
7 Ga0074278_131062 3300005721 Unclassified 11319
8 Ga0466706_039111 3300042599 Bacteria 2312
9 Ga0466707_387069 3300042601 Bacteria 86246
10 Ga0466733_033054 3300042659 Bacteria 15005
11 Ga0562376_0359 3300056857 Unclassified 87384
12 Ga0255576_1000002 3300026558 Bacteria 294856
13 Ga0466656_190495 3300042550 Bacteria 1388
14 Ga0466696_226682 3300042596 Bacteria 7480
15 Ga0123355_10388949 3300009826 Bacteria 1810
16 Ga0123353_10303439 3300010167 Bacteria 2435
17 Ga0466705_414914 3300042612 Bacteria 16359
18 JGI24703J35330_11748860 3300002501 Bacteria 57330
19 Ga0466704_419901 3300042643 Bacteria 4506
20 Ga0466704_489848 3300042643 Unclassified 8728
21 Ga0562379_0009 3300056790 Bacteria 1927879
22 Ga0562377_0413 3300056842 Unclassified 75935
23 Ga0562377_1546 3300056842 Bacteria 22819
24 Ga0562375_0018 3300056856 Bacteria 940838
25 Ga0562374_0725 3300057007 Bacteria 48750
26 Ga0255572_1000643 3300026175 Bacteria 42323
27 Ga0123355_10576906 3300009826 Bacteria 1347
28 Ga0466705_450754 3300042612 Bacteria 12241
29 Ga0466715_347547 3300042616 Bacteria 1853
30 JGI24700J35501_10930625 3300002508 Bacteria 16998
31 Ga0074278_134484 3300005721 Unclassified 8050
32 Ga0111035_105495 3300007901 Bacteria 9718
33 Ga0466706_057203 3300042599 Bacteria 23442
34 Ga0466706_113114 3300042599 Bacteria 24078
35 Ga0466700_363567 3300042600 Bacteria 7780
36 Ga0466707_112060 3300042601 Bacteria 1390
37 Ga0562377_0008 3300056842 Bacteria 1610398
38 Ga0562375_0525 3300056856 Bacteria 77345
39 Ga0255572_1000075 3300026175 Bacteria 79685
40 Ga0255575_1000001 3300026559 Bacteria 210766
41 Ga0415639_006031 3300038395 Bacteria 24237
42 Ga0415639_063843 3300038395 Bacteria 9362
43 Ga0123353_10006090 3300010167 Unclassified 15994
44 Ga0123353_10039832 3300010167 Bacteria 7404
45 Ga0466705_357705 3300042612 Bacteria 8644
46 Ga0466724_28917 3300042649 Bacteria 19936
47 Ga0466727_292510 3300042655 Bacteria 20952
48 Ga0466706_031560 3300042599 Unclassified 1623
49 Ga0466706_262106 3300042599 Bacteria 3234
50 Ga0466707_156642 3300042601 Bacteria 83711
51 Ga0466714_001938 3300042603 Bacteria 27309
52 Ga0562379_0011 3300056790 Bacteria 1623141
53 Ga0466723_014071 3300042618 Bacteria 4439
54 IMNBL1DRAFT_c0006047 3300000062 Bacteria 6737
55 Ga0466731_058250 3300042622 Bacteria 4499
56 Ga0466706_126729 3300042599 Bacteria 1915
57 Ga0466706_130883 3300042599 Unclassified 2108
58 Ga0466714_042010 3300042603 Bacteria 10641
59 Ga0123356_10124854 3300010049 Unclassified 2511
60 Ga0123353_10288607 3300010167 Bacteria 2513
61 Ga0123353_10539665 3300010167 Bacteria 1686
62 2227535748 2225789004 Bacteria 16072
63 HBC_ctgsDRAFT_1002228 3300000333 Bacteria 4397
64 Ga0102734_1000142 3300007129 Bacteria 38625
65 Ga0466727_088990 3300042655 Bacteria 31813
66 Ga0466706_115939 3300042599 Bacteria 29469
67 Ga0466707_091977 3300042601 Bacteria 1605
68 Ga0466707_126663 3300042601 Bacteria 75061
69 Ga0466714_004005 3300042603 Bacteria 23670
70 Ga0562376_0484 3300056857 Unclassified 72077
71 Ga0415639_048598 3300038395 Bacteria 11476
72 Ga0123355_10227580 3300009826 Bacteria 2669
73 Ga0123356_10013783 3300010049 Bacteria 7785
74 Ga0123356_10102417 3300010049 Bacteria 2749
75 Ga0123353_10229479 3300010167 Bacteria 2896
76 Ga0466723_058375 3300042618 Bacteria 5262
77 IMNBL1DRAFT_c0000210 3300000062 Bacteria 51304
78 JGI24702J35022_10161322 3300002462 Bacteria 1263
79 CVPL010L_1000254 3300002932 Unclassified 27217
80 Ga0072941_1035013 3300005201 Bacteria 36026
81 Ga0466704_153708 3300042643 Bacteria 1576
82 Ga0466701_095476 3300042598 Bacteria 1660
83 Ga0466700_247905 3300042600 Bacteria 54776
84 Ga0562375_0843 3300056856 Bacteria 51409
85 Ga0123356_10250715 3300010049 Bacteria 1848
86 Ga0466726_118401 3300042619 Bacteria 32484
87 2211830525 2209111004 Bacteria 29340
88 2227247455 2225789004 Unclassified 31967
89 HBC_ctgsDRAFT_1000963 3300000333 Bacteria 6260
90 JGI24703J35330_11748625 3300002501 Bacteria 22557
91 JGI24703J35330_11748859 3300002501 Bacteria 57247
92 Ga0068302_10011471 3300005071 Unclassified 15182
93 Ga0466735_007727 3300042624 Bacteria 126549
94 Ga0466708_266378 3300042652 Bacteria 17902
95 Ga0466706_039709 3300042599 Bacteria 84247
96 Ga0466706_073321 3300042599 Bacteria 40773
97 Ga0466713_153008 3300042602 Bacteria 19558
98 Ga0466714_002885 3300042603 Bacteria 1876

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF05496 RuvB_N Holliday junction DNA helicase RuvB P-loop domain 19 177 0.99
PF05491 RuvB_C RuvB C-terminal winged helix domain 256 325 0.98
PF17864 AAA_lid_4 RuvB AAA lid domain 180 254 0.96
PF00004 AAA ATPase family associated with various cellular activities (AAA) 54 178 0.94
PF06068 TIP49 TIP49 P-loop domain 26 82 0.9
PF07728 AAA_5 AAA domain (dynein-related subfamily) 53 171 0.86

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF06068 GO:0005524 ATP binding MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.