Protein Family IF04193
Metagenome
Isolate
202
Members
72
Samples
190
Scaffolds
325.94
Avg Length
Representative Sequence
- ID
- 3300024493|Ga0264413_140667|Ga0264413_1406672
- Length
- 369 aa
- Sequence
- MMNGITFHNPEFLYLLFCLPLLAGWKWWRHKRTVAKISVSNIELLAVAKKSLRQRLMVLPFVLRLLTLTILVIAMARPQSSLKGRQENIEGVDIMLALDISGSMLAEDFLPNRMEAAKSVAADFVRSRPSDRMGIVVFSGESFTQCPLTIDHSILLSQIDAIKTGMIEDGTAIGDGLATAINRLKNSTAISKTIILLTDGVNNMGSIAPITAAEIASVYGIRVYTIGVGTHGTAPYPFQTPFGKQYQNVEVQLDEPMLKQMAETTGGQYFRATNKNKLKAIFEDIDKMEKTKIEVLNYERKHEEFKLLLWIALGLFLLELLLSYSXXXXSAIRVESRKSTTSRCGFDDLFGHFGKYECRRHPAQSFETL
Sample Types
Isolate
5.9%
Metagenome
94.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.7%
Unclassified
22.1%
Kalotermitidae
20.6%
Termopsidae
5.9%
Armadillidiidae
4.4%
Passalidae
2.9%
Hodotermitidae
1.5%
Culicidae
1.5%
Rhinotermitidae
1.5%
Taxonomy
Archaea
0
Bacteria
192
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820767225 | Unclassified Bacteroidetes Lab288P3bin34 | Isolate | Unclassified |
| 2 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 5 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 6 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 7 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 8 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 9 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 10 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 11 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 12 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 13 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 14 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 15 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 16 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 17 | 2820750388 | Unclassified Bacteroidetes Nt197P3bin50 | Isolate | Unclassified |
| 18 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 19 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 20 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 21 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 22 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 23 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 24 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 25 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 26 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 27 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 28 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 29 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 30 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 31 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 32 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 33 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 34 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 35 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 36 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 37 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 38 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 39 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 40 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 41 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 42 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 43 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 44 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 45 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 46 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 47 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 48 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 49 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 50 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 51 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 52 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 53 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 54 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 55 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 56 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 57 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 58 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 59 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 60 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 61 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 62 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 63 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 64 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 65 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 66 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 67 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 68 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 69 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 70 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 71 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 72 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_082818 | 3300042611 | Bacteria | 2021 |
| 2 | Ga0466733_020123 | 3300042659 | Bacteria | 4206 |
| 3 | Ga0466706_002839 | 3300042599 | Bacteria | 28488 |
| 4 | Ga0466713_057198 | 3300042602 | Bacteria | 57543 |
| 5 | Ga0466722_059338 | 3300042609 | Bacteria | 9524 |
| 6 | Ga0466728_048806 | 3300042620 | Bacteria | 9925 |
| 7 | Ga0466656_381850 | 3300042550 | Unclassified | 5457 |
| 8 | Ga0466693_105274 | 3300042592 | Bacteria | 2315 |
| 9 | Ga0466691_164012 | 3300042593 | Unclassified | 2206 |
| 10 | Ga0466696_111122 | 3300042596 | Bacteria | 5174 |
| 11 | Ga0466696_476890 | 3300042596 | Bacteria | 6050 |
| 12 | 2227591283 | 2225789004 | Bacteria | 48146 |
| 13 | Ga0068302_10375961 | 3300005071 | Bacteria | 2747 |
| 14 | Ga0123356_10502590 | 3300010049 | Bacteria | 1368 |
| 15 | Ga0466703_143580 | 3300042636 | Bacteria | 20242 |
| 16 | Ga0466703_160265 | 3300042636 | Bacteria | 23736 |
| 17 | Ga0466703_168329 | 3300042636 | Bacteria | 3242 |
| 18 | Ga0466704_136608 | 3300042643 | Bacteria | 15825 |
| 19 | Ga0466709_182379 | 3300042648 | Bacteria | 13931 |
| 20 | Ga0466727_139416 | 3300042655 | Bacteria | 8928 |
| 21 | Ga0466706_178803 | 3300042599 | Bacteria | 1798 |
| 22 | Ga0466706_196142 | 3300042599 | Bacteria | 22966 |
| 23 | Ga0466706_288797 | 3300042599 | Bacteria | 1467 |
| 24 | Ga0466707_198931 | 3300042601 | Bacteria | 8885 |
| 25 | Ga0466713_035670 | 3300042602 | Bacteria | 9093 |
| 26 | Ga0466713_070006 | 3300042602 | Bacteria | 89523 |
| 27 | Ga0466714_031378 | 3300042603 | Bacteria | 17961 |
| 28 | Ga0466719_234854 | 3300042606 | Bacteria | 2797 |
| 29 | Ga0466698_359284 | 3300042610 | Bacteria | 1495 |
| 30 | Ga0466705_422513 | 3300042612 | Bacteria | 14401 |
| 31 | Ga0466705_477694 | 3300042612 | Bacteria | 20351 |
| 32 | Ga0466711_032112 | 3300042615 | Bacteria | 6208 |
| 33 | Ga0466723_008388 | 3300042618 | Bacteria | 3922 |
| 34 | Ga0466723_152589 | 3300042618 | Bacteria | 2420 |
| 35 | Ga0466726_048383 | 3300042619 | Bacteria | 29520 |
| 36 | Ga0466728_071249 | 3300042620 | Bacteria | 13016 |
| 37 | Ga0160431_101799 | 3300012828 | Bacteria | 5647 |
| 38 | Ga0264413_140667 | 3300024493 | Bacteria | 1869 |
| 39 | Ga0466657_016523 | 3300042582 | Bacteria | 6840 |
| 40 | Ga0466690_140491 | 3300042590 | Bacteria | 5286 |
| 41 | Ga0466690_349805 | 3300042590 | Bacteria | 10041 |
| 42 | Ga0466696_232902 | 3300042596 | Bacteria | 1706 |
| 43 | 2227591276 | 2225789004 | Bacteria | 49034 |
| 44 | IMNBL1DRAFT_c0000483 | 3300000062 | Bacteria | 33213 |
| 45 | Ga0072941_1137062 | 3300005201 | Bacteria | 3773 |
| 46 | Ga0466703_057665 | 3300042636 | Bacteria | 22398 |
| 47 | Ga0466709_339484 | 3300042648 | Bacteria | 169915 |
| 48 | Ga0466724_65632 | 3300042649 | Bacteria | 2424 |
| 49 | Ga0466732_343472 | 3300042656 | Bacteria | 1855 |
| 50 | Ga0466733_003820 | 3300042659 | Bacteria | 5829 |
| 51 | Ga0466733_117641 | 3300042659 | Bacteria | 3338 |
| 52 | Ga0466706_070252 | 3300042599 | Bacteria | 1785 |
| 53 | Ga0466716_141048 | 3300042605 | Bacteria | 6242 |
| 54 | Ga0466716_166894 | 3300042605 | Bacteria | 8161 |
| 55 | Ga0466722_242773 | 3300042609 | Bacteria | 10208 |
| 56 | Ga0466711_268649 | 3300042615 | Bacteria | 10972 |
| 57 | Ga0466711_363285 | 3300042615 | Bacteria | 32228 |
| 58 | Ga0466715_530925 | 3300042616 | Bacteria | 21537 |
| 59 | Ga0466723_107788 | 3300042618 | Bacteria | 1468 |
| 60 | Ga0466728_016252 | 3300042620 | Bacteria | 1684 |
| 61 | Ga0160452_101837 | 3300012834 | Bacteria | 5387 |
| 62 | Ga0466657_357223 | 3300042582 | Bacteria | 5077 |
| 63 | Ga0466690_226424 | 3300042590 | Bacteria | 22270 |
| 64 | Ga0466693_028517 | 3300042592 | Bacteria | 3697 |
| 65 | Ga0466694_085252 | 3300042594 | Bacteria | 1509 |
| 66 | Ga0466696_292450 | 3300042596 | Bacteria | 2408 |
| 67 | JGI24705J35276_12238193 | 3300002504 | Bacteria | 17080 |
| 68 | Ga0123355_10000217 | 3300009826 | Bacteria | 72204 |
| 69 | Ga0123356_10089583 | 3300010049 | Bacteria | 2927 |
| 70 | Ga0123353_10165476 | 3300010167 | Unclassified | 3516 |
| 71 | Ga0123354_10052709 | 3300010882 | Bacteria | 6125 |
| 72 | Ga0466734_048441 | 3300042623 | Bacteria | 1958 |
| 73 | Ga0466735_208382 | 3300042624 | Bacteria | 2247 |
| 74 | Ga0466704_605489 | 3300042643 | Bacteria | 25005 |
| 75 | Ga0466725_332927 | 3300042654 | Bacteria | 2692 |
| 76 | Ga0466727_128385 | 3300042655 | Bacteria | 2660 |
| 77 | Ga0466707_414097 | 3300042601 | Bacteria | 13795 |
| 78 | Ga0466713_035234 | 3300042602 | Bacteria | 43574 |
| 79 | Ga0466713_042132 | 3300042602 | Bacteria | 1693 |
| 80 | Ga0466713_073620 | 3300042602 | Bacteria | 10146 |
| 81 | Ga0466716_048826 | 3300042605 | Bacteria | 7788 |
| 82 | Ga0466710_435486 | 3300042613 | Bacteria | 1869 |
| 83 | Ga0466712_152888 | 3300042614 | Bacteria | 2164 |
| 84 | Ga0466715_080397 | 3300042616 | Bacteria | 7925 |
| 85 | Ga0466723_203874 | 3300042618 | Bacteria | 22262 |
| 86 | Ga0160433_100027 | 3300012846 | Bacteria | 176280 |
| 87 | Ga0160448_104627 | 3300012854 | Bacteria | 3786 |
| 88 | Ga0466690_113107 | 3300042590 | Unclassified | 4145 |
| 89 | Ga0466696_031548 | 3300042596 | Bacteria | 10280 |
| 90 | Ga0466696_049113 | 3300042596 | Bacteria | 63300 |
| 91 | IMNBL1DRAFT_c0006134 | 3300000062 | Bacteria | 6653 |
| 92 | Ga0068305_10074442 | 3300005083 | Bacteria | 15489 |
| 93 | Ga0123355_10000161 | 3300009826 | Bacteria | 81946 |
| 94 | Ga0466731_048332 | 3300042622 | Bacteria | 1592 |
| 95 | Ga0466731_069008 | 3300042622 | Bacteria | 1725 |
| 96 | Ga0466703_029191 | 3300042636 | Bacteria | 4361 |
| 97 | Ga0466703_044193 | 3300042636 | Bacteria | 5224 |
| 98 | Ga0466724_33726 | 3300042649 | Bacteria | 1039 |
| 99 | Ga0466708_184382 | 3300042652 | Bacteria | 8225 |
| 100 | Ga0466708_221398 | 3300042652 | Bacteria | 32840 |
| 101 | Ga0466727_224993 | 3300042655 | Bacteria | 12098 |
| 102 | Ga0466706_125597 | 3300042599 | Bacteria | 31503 |
| 103 | Ga0466719_546936 | 3300042606 | Bacteria | 12915 |
| 104 | Ga0466710_440248 | 3300042613 | Bacteria | 5620 |
| 105 | Ga0466723_131247 | 3300042618 | Bacteria | 27370 |
| 106 | Ga0466723_158422 | 3300042618 | Bacteria | 5611 |
| 107 | Ga0160455_100163 | 3300012837 | Bacteria | 72594 |
| 108 | Ga0160457_1001675 | 3300012858 | Bacteria | 5671 |
| 109 | Ga0466690_129997 | 3300042590 | Unclassified | 3034 |
| 110 | Ga0466690_426101 | 3300042590 | Bacteria | 4218 |
| 111 | Ga0466691_179572 | 3300042593 | Bacteria | 130258 |
| 112 | Ga0123356_10072933 | 3300010049 | Bacteria | 3227 |
| 113 | Ga0466734_041052 | 3300042623 | Bacteria | 2530 |
| 114 | Ga0466735_035697 | 3300042624 | Bacteria | 10327 |
| 115 | Ga0466703_275744 | 3300042636 | Bacteria | 14473 |
| 116 | Ga0466704_020070 | 3300042643 | Bacteria | 4474 |
| 117 | Ga0466708_053789 | 3300042652 | Bacteria | 4201 |
| 118 | Ga0466708_368256 | 3300042652 | Bacteria | 26611 |
| 119 | Ga0466706_021104 | 3300042599 | Bacteria | 37411 |
| 120 | Ga0466700_015001 | 3300042600 | Bacteria | 10860 |
| 121 | Ga0466714_005263 | 3300042603 | Bacteria | 18418 |
| 122 | Ga0466714_102912 | 3300042603 | Bacteria | 25171 |
| 123 | Ga0466721_160779 | 3300042608 | Bacteria | 21993 |
| 124 | Ga0466722_214424 | 3300042609 | Bacteria | 4734 |
| 125 | Ga0466711_326852 | 3300042615 | Bacteria | 4197 |
| 126 | Ga0466715_142775 | 3300042616 | Unclassified | 5955 |
| 127 | Ga0466715_470278 | 3300042616 | Bacteria | 8666 |
| 128 | Ga0466715_478991 | 3300042616 | Unclassified | 15299 |
| 129 | Ga0466723_042859 | 3300042618 | Bacteria | 12089 |
| 130 | Ga0466723_287880 | 3300042618 | Bacteria | 4213 |
| 131 | Ga0466726_444394 | 3300042619 | Bacteria | 1576 |
| 132 | Ga0466728_232878 | 3300042620 | Bacteria | 14732 |
| 133 | Ga0466728_235470 | 3300042620 | Bacteria | 23707 |
| 134 | Ga0466656_132996 | 3300042550 | Bacteria | 1202 |
| 135 | Ga0466691_016435 | 3300042593 | Bacteria | 9445 |
| 136 | JGI24702J35022_10000076 | 3300002462 | Bacteria | 43662 |
| 137 | JGI24702J35022_10003685 | 3300002462 | Bacteria | 9219 |
| 138 | Ga0123355_10006152 | 3300009826 | Bacteria | 17714 |
| 139 | Ga0123356_10189982 | 3300010049 | Bacteria | 2084 |
| 140 | Ga0123353_10000019 | 3300010167 | Bacteria | 185006 |
| 141 | Ga0123353_10002109 | 3300010167 | Bacteria | 24588 |
| 142 | Ga0123353_10066470 | 3300010167 | Bacteria | 5787 |
| 143 | Ga0123354_10344472 | 3300010882 | Bacteria | 1338 |
| 144 | Ga0466704_333042 | 3300042643 | Bacteria | 20009 |
| 145 | Ga0466709_204440 | 3300042648 | Bacteria | 87623 |
| 146 | Ga0466708_119301 | 3300042652 | Unclassified | 1081 |
| 147 | Ga0466727_303900 | 3300042655 | Bacteria | 4546 |
| 148 | Ga0466705_133667 | 3300042612 | Bacteria | 38257 |
| 149 | Ga0466705_160845 | 3300042612 | Bacteria | 6396 |
| 150 | Ga0466705_218445 | 3300042612 | Bacteria | 3510 |
| 151 | Ga0466706_040830 | 3300042599 | Bacteria | 11106 |
| 152 | Ga0466714_166348 | 3300042603 | Bacteria | 7399 |
| 153 | Ga0466719_244564 | 3300042606 | Bacteria | 6273 |
| 154 | Ga0466722_222249 | 3300042609 | Bacteria | 5237 |
| 155 | Ga0466710_002707 | 3300042613 | Bacteria | 15470 |
| 156 | Ga0466715_068346 | 3300042616 | Bacteria | 14735 |
| 157 | Ga0466690_366148 | 3300042590 | Bacteria | 9728 |
| 158 | Ga0466691_207490 | 3300042593 | Bacteria | 15619 |
| 159 | Ga0466695_178590 | 3300042595 | Bacteria | 10907 |
| 160 | IMNBL1DRAFT_c0008230 | 3300000062 | Bacteria | 5340 |
| 161 | IMNBL1DRAFT_c0031038 | 3300000062 | Bacteria | 1949 |
| 162 | Ga0123353_10071832 | 3300010167 | Bacteria | 5561 |
| 163 | Ga0466734_118681 | 3300042623 | Bacteria | 3166 |
| 164 | Ga0466709_237040 | 3300042648 | Bacteria | 13320 |
| 165 | Ga0466708_094334 | 3300042652 | Bacteria | 1394 |
| 166 | Ga0466705_211281 | 3300042612 | Bacteria | 10258 |
| 167 | Ga0466732_355038 | 3300042656 | Bacteria | 1834 |
| 168 | Ga0466733_061170 | 3300042659 | Bacteria | 1655 |
| 169 | Ga0466706_048142 | 3300042599 | Bacteria | 37807 |
| 170 | Ga0466706_165313 | 3300042599 | Bacteria | 60368 |
| 171 | Ga0466713_005148 | 3300042602 | Bacteria | 13984 |
| 172 | Ga0466714_018521 | 3300042603 | Bacteria | 46643 |
| 173 | Ga0466719_352394 | 3300042606 | Bacteria | 20000 |
| 174 | Ga0466719_509966 | 3300042606 | Bacteria | 7822 |
| 175 | Ga0466722_217106 | 3300042609 | Bacteria | 2910 |
| 176 | Ga0466711_018792 | 3300042615 | Bacteria | 12875 |
| 177 | Ga0466723_352722 | 3300042618 | Bacteria | 5727 |
| 178 | Ga0466728_218884 | 3300042620 | Unclassified | 1681 |
| 179 | Ga0466690_170601 | 3300042590 | Bacteria | 1472 |
| 180 | Ga0466691_055360 | 3300042593 | Bacteria | 60253 |
| 181 | Ga0466699_196665 | 3300042597 | Bacteria | 2770 |
| 182 | IMNBL1DRAFT_c0009827 | 3300000062 | Bacteria | 4667 |
| 183 | JGI24702J35022_10010005 | 3300002462 | Bacteria | 5314 |
| 184 | Ga0068302_10021604 | 3300005071 | Unclassified | 2236 |
| 185 | Ga0072940_1204458 | 3300005200 | Bacteria | 1810 |
| 186 | Ga0123353_10165554 | 3300010167 | Bacteria | 3515 |
| 187 | Ga0466730_010897 | 3300042625 | Bacteria | 2402 |
| 188 | Ga0466703_362470 | 3300042636 | Bacteria | 4438 |
| 189 | Ga0466704_050971 | 3300042643 | Bacteria | 11653 |
| 190 | Ga0466709_308187 | 3300042648 | Bacteria | 11943 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.