Protein Family IF04180
Metagenome
Isolate
117
Members
51
Samples
104
Scaffolds
271.62
Avg Length
Representative Sequence
- ID
- 3300024493|Ga0264413_122515|Ga0264413_1225155
- Length
- 285 aa
- Sequence
- MADTYAALLNKVRETRPLVHHITNYVTVNDCANITLAVGASPVMADAIGEAAEFAAIARAVVLNTGTLNERTIPSMIAAGKAANAKKIPVILDPVGAGASKLRNDTIALLTSELKLSVIRGNISEIKFAAGLNSQTKGVDASDSDLAGADSAGTAQALARKLDCVVVISGAIDAISDGAKTIFVENGHPMLGNLTGTGCMCSSLIGCFCGAAPDEPLAAAAAAMMCMGIAGELAYKNAGQHGTRRRGSLEPRFPPGNGSFRAALHDAVSRMDAATFERMARYHEE
Sample Types
Isolate
11.1%
Metagenome
88.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
48.0%
Unclassified
22.0%
Kalotermitidae
16.0%
Formicidae
4.0%
Rhinotermitidae
4.0%
Hodotermitidae
2.0%
Termopsidae
2.0%
Apidae
2.0%
Taxonomy
Archaea
1
Bacteria
112
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 2 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 3 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 7 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 8 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 9 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 10 | 2820504582 | Unclassified Firmicutes Lab288P1bin5 | Isolate | Unclassified |
| 11 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 12 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 13 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
| 14 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 15 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 16 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 17 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 18 | 2228664003 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA | Metagenome | Termitidae |
| 19 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 20 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 21 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 22 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 23 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 24 | 2820238527 | Unclassified Firmicutes Th196P3bin90 | Isolate | Unclassified |
| 25 | 2820490862 | Unclassified Firmicutes Lab288P1bin64 | Isolate | Unclassified |
| 26 | 2820512088 | Unclassified Firmicutes Lab288P1bin4 | Isolate | Unclassified |
| 27 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 28 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 29 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 30 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 31 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 32 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 33 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 34 | 2820280018 | Unclassified Firmicutes Th196P3bin149 | Isolate | Unclassified |
| 35 | 2820487239 | Unclassified Firmicutes Lab288P1bin71 | Isolate | Unclassified |
| 36 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 37 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 38 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 39 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 40 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 41 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 42 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 43 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 44 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 45 | 2571042003 | Stenoxybacter acetivorans DSM 19021 | Isolate | Rhinotermitidae |
| 46 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 47 | 2820380671 | Unclassified Firmicutes Nt197P1bin4 | Isolate | Unclassified |
| 48 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 49 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 50 | 2956928875 | Bombilactobacillus apium DCY120 | Isolate | Apidae |
| 51 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_106067 | 3300042612 | Bacteria | 3218 |
| 2 | Ga0466732_075473 | 3300042656 | Bacteria | 3372 |
| 3 | Ga0466732_268355 | 3300042656 | Bacteria | 2477 |
| 4 | Ga0415639_061549 | 3300038395 | Bacteria | 4601 |
| 5 | Ga0415639_106679 | 3300038395 | Bacteria | 1018 |
| 6 | Ga0466656_309667 | 3300042550 | Bacteria | 1083 |
| 7 | Ga0466693_200383 | 3300042592 | Bacteria | 5806 |
| 8 | Ga0466691_220710 | 3300042593 | Bacteria | 4601 |
| 9 | Ga0466699_184636 | 3300042597 | Bacteria | 3518 |
| 10 | Ga0466699_433739 | 3300042597 | Bacteria | 2515 |
| 11 | Ga0466718_013102 | 3300042617 | Bacteria | 7288 |
| 12 | Ga0123356_10250949 | 3300010049 | Bacteria | 1847 |
| 13 | Ga0466706_137176 | 3300042599 | Bacteria | 2817 |
| 14 | Ga0466700_279913 | 3300042600 | Bacteria | 2958 |
| 15 | Ga0466716_359699 | 3300042605 | Bacteria | 1805 |
| 16 | Ga0466719_012866 | 3300042606 | Bacteria | 1258 |
| 17 | Nasutiter_Contig01602 | 2030936001 | Bacteria | 1662 |
| 18 | 2230954234 | 2228664003 | Bacteria | 8326 |
| 19 | AustNasuHG_c1007227 | 3300000089 | Bacteria | 3951 |
| 20 | AustNasuHG_c1036032 | 3300000089 | Bacteria | 1291 |
| 21 | JGI24695J34938_10078293 | 3300002450 | Bacteria | 1369 |
| 22 | Ga0466725_050914 | 3300042654 | Bacteria | 8734 |
| 23 | Ga0466732_037934 | 3300042656 | Bacteria | 15040 |
| 24 | Ga0264413_100590 | 3300024493 | Bacteria | 15397 |
| 25 | Ga0264413_113631 | 3300024493 | Bacteria | 3911 |
| 26 | Ga0415639_055805 | 3300038395 | Bacteria | 17401 |
| 27 | Ga0415639_061551 | 3300038395 | Unclassified | 4497 |
| 28 | Ga0415639_076142 | 3300038395 | Bacteria | 2946 |
| 29 | Ga0466693_149274 | 3300042592 | Bacteria | 4814 |
| 30 | Ga0466699_120330 | 3300042597 | Bacteria | 14707 |
| 31 | Ga0466718_096481 | 3300042617 | Bacteria | 8065 |
| 32 | Ga0466706_009907 | 3300042599 | Bacteria | 6197 |
| 33 | Ga0466706_079481 | 3300042599 | Bacteria | 3634 |
| 34 | Ga0466719_552890 | 3300042606 | Bacteria | 2416 |
| 35 | Ga0074263_102829 | 3300005485 | Bacteria | 1372 |
| 36 | Ga0074263_114088 | 3300005485 | Bacteria | 2085 |
| 37 | Ga0466733_028654 | 3300042659 | Bacteria | 1626 |
| 38 | Ga0466690_205896 | 3300042590 | Bacteria | 4950 |
| 39 | Ga0466693_054350 | 3300042592 | Bacteria | 1231 |
| 40 | Ga0466699_113958 | 3300042597 | Bacteria | 5970 |
| 41 | Ga0123355_10577075 | 3300009826 | Bacteria | 1346 |
| 42 | Ga0123356_10046687 | 3300010049 | Bacteria | 4030 |
| 43 | Ga0466706_023392 | 3300042599 | Bacteria | 1822 |
| 44 | JGI24695J34938_10001124 | 3300002450 | Bacteria | 24010 |
| 45 | Ga0072940_1015796 | 3300005200 | Bacteria | 3911 |
| 46 | Ga0264413_102346 | 3300024493 | Bacteria | 9020 |
| 47 | Ga0264413_102347 | 3300024493 | Bacteria | 16898 |
| 48 | Ga0264413_102417 | 3300024493 | Bacteria | 2388 |
| 49 | Ga0415639_084804 | 3300038395 | Bacteria | 2483 |
| 50 | Ga0415639_088907 | 3300038395 | Bacteria | 4083 |
| 51 | Ga0466690_215755 | 3300042590 | Bacteria | 1178 |
| 52 | Ga0466691_097327 | 3300042593 | Bacteria | 1218 |
| 53 | Ga0123355_10006708 | 3300009826 | Bacteria | 17117 |
| 54 | Ga0123353_10536384 | 3300010167 | Bacteria | 1692 |
| 55 | Ga0466706_150973 | 3300042599 | Bacteria | 9813 |
| 56 | Ga0466720_025427 | 3300042607 | Bacteria | 9402 |
| 57 | Ga0466720_165550 | 3300042607 | Bacteria | 4948 |
| 58 | JGI24695J34938_10044483 | 3300002450 | Bacteria | 1974 |
| 59 | JGI24703J35330_11747585 | 3300002501 | Unclassified | 7388 |
| 60 | Ga0264413_102418 | 3300024493 | Bacteria | 4931 |
| 61 | Ga0466693_117080 | 3300042592 | Bacteria | 1182 |
| 62 | Ga0466699_141435 | 3300042597 | Bacteria | 2527 |
| 63 | Ga0123353_10360804 | 3300010167 | Bacteria | 2184 |
| 64 | Ga0466701_082415 | 3300042598 | Bacteria | 1050 |
| 65 | Ga0466706_131390 | 3300042599 | Bacteria | 4162 |
| 66 | AustNasuHG_c1045620 | 3300000089 | Bacteria | 1000 |
| 67 | JGI24695J34938_10006302 | 3300002450 | Bacteria | 7174 |
| 68 | JGI24695J34938_10017893 | 3300002450 | Bacteria | 3559 |
| 69 | JGI24695J34938_10049876 | 3300002450 | Unclassified | 1838 |
| 70 | JGI24702J35022_10003545 | 3300002462 | Bacteria | 9410 |
| 71 | Ga0466731_259770 | 3300042622 | Bacteria | 1873 |
| 72 | Ga0466709_350609 | 3300042648 | Bacteria | 4679 |
| 73 | Ga0264413_122515 | 3300024493 | Bacteria | 5440 |
| 74 | Ga0255572_1000003 | 3300026175 | Bacteria | 262489 |
| 75 | Ga0466699_019370 | 3300042597 | Bacteria | 3140 |
| 76 | Ga0466711_365980 | 3300042615 | Bacteria | 8341 |
| 77 | Ga0123356_10494281 | 3300010049 | Bacteria | 1378 |
| 78 | Ga0123353_10585739 | 3300010167 | Bacteria | 1599 |
| 79 | Ga0466719_100899 | 3300042606 | Bacteria | 1688 |
| 80 | Ga0466729_236377 | 3300042621 | Bacteria | 1426 |
| 81 | Ga0466693_173308 | 3300042592 | Archaea | 3193 |
| 82 | Ga0466696_461324 | 3300042596 | Bacteria | 10031 |
| 83 | Ga0466699_126459 | 3300042597 | Bacteria | 3672 |
| 84 | Ga0466718_067721 | 3300042617 | Bacteria | 37185 |
| 85 | Ga0466718_103345 | 3300042617 | Bacteria | 2253 |
| 86 | Ga0466707_146352 | 3300042601 | Bacteria | 3991 |
| 87 | Ga0466720_234022 | 3300042607 | Bacteria | 1027 |
| 88 | Ga0466735_061663 | 3300042624 | Bacteria | 2184 |
| 89 | Ga0466732_116067 | 3300042656 | Bacteria | 16533 |
| 90 | Ga0264413_112604 | 3300024493 | Bacteria | 3445 |
| 91 | Ga0264413_114031 | 3300024493 | Bacteria | 4945 |
| 92 | Ga0415639_079685 | 3300038395 | Unclassified | 1204 |
| 93 | Ga0466693_176072 | 3300042592 | Bacteria | 1989 |
| 94 | Ga0466693_427809 | 3300042592 | Bacteria | 11122 |
| 95 | Ga0466711_484818 | 3300042615 | Bacteria | 2972 |
| 96 | Ga0466718_053041 | 3300042617 | Bacteria | 10281 |
| 97 | Ga0123355_10278728 | 3300009826 | Bacteria | 2311 |
| 98 | Ga0123356_10007406 | 3300010049 | Bacteria | 10950 |
| 99 | Ga0123356_10054547 | 3300010049 | Bacteria | 3723 |
| 100 | Ga0123353_10336194 | 3300010167 | Bacteria | 2283 |
| 101 | Ga0123353_10363169 | 3300010167 | Bacteria | 2175 |
| 102 | Ga0466706_045491 | 3300042599 | Bacteria | 29696 |
| 103 | Ga0466721_087143 | 3300042608 | Bacteria | 3388 |
| 104 | JGI24695J34938_10028123 | 3300002450 | Bacteria | 2646 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01256 | GO:0016836 | hydro-lyase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.