Protein Family IF04165
Metagenome
Isolate
167
Members
53
Samples
147
Scaffolds
148.81
Avg Length
Representative Sequence
- ID
- 3300024493|Ga0264413_108298|Ga0264413_10829814
- Length
- 175 aa
- Sequence
- MIKQGKGKIAQRTVSADSRIFRSGGGVLAEVILKILKVHRRVTLPRYESEGASGMDLRAFLDSDVTIQPLCRSKIPTGLRLEIPFGYEAQIRPRSGMANNFGLTVLNSPGTIDSDYRGDIEIILVNLSKEDAVVKDGQRIAQLVIAPVCRAVITLSEALEESGRGSGGFGSTGSF
Sample Types
Isolate
12.0%
Metagenome
88.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
49.0%
Unclassified
39.2%
Rhinotermitidae
3.9%
Termopsidae
3.9%
Kalotermitidae
2.0%
Kiwaidae
2.0%
Taxonomy
Archaea
0
Bacteria
157
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 2 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 3 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 4 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 5 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 6 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 7 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 8 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 9 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 10 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 11 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 12 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 13 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 14 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 15 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 16 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 17 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 18 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 19 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 20 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 21 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 22 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 23 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 24 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 25 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 26 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 27 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 28 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 29 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 30 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 31 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 32 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 33 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 34 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 35 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 36 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 37 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 38 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 39 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 40 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 41 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 42 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 43 | 3300013007 | Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts | Metagenome | Kiwaidae |
| 44 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 45 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 46 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 47 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 48 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 49 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 50 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 51 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 52 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 53 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10003993 | 3300010049 | Bacteria | 15325 |
| 2 | Ga0123356_10693401 | 3300010049 | Bacteria | 1187 |
| 3 | Ga0466712_096872 | 3300042614 | Bacteria | 7838 |
| 4 | Ga0466718_033723 | 3300042617 | Bacteria | 18615 |
| 5 | Ga0466718_042091 | 3300042617 | Bacteria | 4512 |
| 6 | Ga0466700_202693 | 3300042600 | Bacteria | 1076 |
| 7 | Ga0466700_487739 | 3300042600 | Bacteria | 1373 |
| 8 | Ga0466720_004826 | 3300042607 | Bacteria | 6572 |
| 9 | Ga0415639_065094 | 3300038395 | Bacteria | 5877 |
| 10 | Ga0415639_129633 | 3300038395 | Bacteria | 2594 |
| 11 | Ga0466692_178538 | 3300042591 | Bacteria | 2346 |
| 12 | Ga0466693_348478 | 3300042592 | Bacteria | 1813 |
| 13 | Ga0466695_287473 | 3300042595 | Bacteria | 18164 |
| 14 | Ga0466699_237348 | 3300042597 | Bacteria | 1040 |
| 15 | Ga0466702_018710 | 3300042635 | Bacteria | 4081 |
| 16 | Ga0466702_435027 | 3300042635 | Bacteria | 1632 |
| 17 | JGI24695J34938_10000066 | 3300002450 | Bacteria | 87156 |
| 18 | JGI24695J34938_10008485 | 3300002450 | Bacteria | 5851 |
| 19 | Ga0072940_1003624 | 3300005200 | Bacteria | 4288 |
| 20 | Ga0072941_1122931 | 3300005201 | Bacteria | 2819 |
| 21 | Ga0123356_10005708 | 3300010049 | Bacteria | 12639 |
| 22 | Ga0123356_10031824 | 3300010049 | Bacteria | 4937 |
| 23 | Ga0123356_10046794 | 3300010049 | Bacteria | 4025 |
| 24 | Ga0123356_10047175 | 3300010049 | Bacteria | 4008 |
| 25 | Ga0123356_11516632 | 3300010049 | Bacteria | 827 |
| 26 | Ga0123356_12424597 | 3300010049 | Bacteria | 656 |
| 27 | Ga0466726_292751 | 3300042619 | Bacteria | 2539 |
| 28 | Ga0466720_115816 | 3300042607 | Bacteria | 11492 |
| 29 | Ga0466720_168444 | 3300042607 | Bacteria | 4973 |
| 30 | Ga0264413_108298 | 3300024493 | Bacteria | 20681 |
| 31 | Ga0264413_141000 | 3300024493 | Unclassified | 1847 |
| 32 | Ga0466702_223121 | 3300042635 | Bacteria | 1211 |
| 33 | AustNasuHG_c1000031 | 3300000089 | Bacteria | 33623 |
| 34 | JGI24698J34947_10011422 | 3300002449 | Bacteria | 4877 |
| 35 | JGI24698J34947_10198913 | 3300002449 | Bacteria | 786 |
| 36 | JGI24695J34938_10015935 | 3300002450 | Bacteria | 3841 |
| 37 | Ga0074263_102260 | 3300005485 | Unclassified | 4761 |
| 38 | Ga0123356_10000149 | 3300010049 | Bacteria | 78461 |
| 39 | Ga0123356_10002539 | 3300010049 | Bacteria | 19514 |
| 40 | Ga0123356_11680418 | 3300010049 | Bacteria | 787 |
| 41 | Ga0466715_292530 | 3300042616 | Bacteria | 11267 |
| 42 | Ga0466720_097568 | 3300042607 | Bacteria | 20329 |
| 43 | Ga0466694_116545 | 3300042594 | Bacteria | 5654 |
| 44 | Ga0466694_321401 | 3300042594 | Bacteria | 6028 |
| 45 | Ga0466699_171335 | 3300042597 | Bacteria | 23993 |
| 46 | Ga0466699_313071 | 3300042597 | Bacteria | 4760 |
| 47 | Ga0466731_359050 | 3300042622 | Bacteria | 15410 |
| 48 | Ga0466735_051472 | 3300042624 | Bacteria | 1436 |
| 49 | Ga0466702_266634 | 3300042635 | Bacteria | 4330 |
| 50 | AustNasuHG_c1011850 | 3300000089 | Unclassified | 3018 |
| 51 | JGI24698J34947_10037034 | 3300002449 | Bacteria | 2537 |
| 52 | JGI24698J34947_10043270 | 3300002449 | Bacteria | 2310 |
| 53 | JGI24698J34947_10066583 | 3300002449 | Bacteria | 1752 |
| 54 | JGI24695J34938_10000203 | 3300002450 | Bacteria | 56250 |
| 55 | JGI24695J34938_10000794 | 3300002450 | Bacteria | 29386 |
| 56 | JGI24695J34938_10012449 | 3300002450 | Bacteria | 4506 |
| 57 | Ga0123355_10984776 | 3300009826 | Bacteria | 898 |
| 58 | Ga0123353_10047375 | 3300010167 | Bacteria | 6836 |
| 59 | Ga0123353_11539241 | 3300010167 | Bacteria | 844 |
| 60 | Ga0466712_104485 | 3300042614 | Unclassified | 2227 |
| 61 | Ga0466712_106136 | 3300042614 | Bacteria | 3400 |
| 62 | Ga0466718_003894 | 3300042617 | Bacteria | 4848 |
| 63 | Ga0264413_123932 | 3300024493 | Bacteria | 1548 |
| 64 | Ga0466699_123455 | 3300042597 | Bacteria | 2588 |
| 65 | Ga0466731_416318 | 3300042622 | Bacteria | 7678 |
| 66 | JGI24698J34947_10082330 | 3300002449 | Bacteria | 1505 |
| 67 | JGI24695J34938_10000108 | 3300002450 | Bacteria | 73543 |
| 68 | JGI24695J34938_10004377 | 3300002450 | Bacteria | 9305 |
| 69 | JGI24695J34938_10015965 | 3300002450 | Bacteria | 3835 |
| 70 | JGI24695J34938_10048488 | 3300002450 | Bacteria | 1870 |
| 71 | Ga0074263_109446 | 3300005485 | Bacteria | 4849 |
| 72 | Ga0466732_382322 | 3300042656 | Bacteria | 14917 |
| 73 | Ga0123353_10551579 | 3300010167 | Unclassified | 1662 |
| 74 | Ga0466718_099464 | 3300042617 | Bacteria | 1188 |
| 75 | Ga0466700_207602 | 3300042600 | Bacteria | 1856 |
| 76 | Ga0466700_333483 | 3300042600 | Bacteria | 8361 |
| 77 | Ga0466720_041761 | 3300042607 | Bacteria | 19031 |
| 78 | Ga0466698_307484 | 3300042610 | Bacteria | 1302 |
| 79 | Ga0264413_101244 | 3300024493 | Bacteria | 7858 |
| 80 | Ga0264413_117635 | 3300024493 | Bacteria | 1700 |
| 81 | Ga0264413_120254 | 3300024493 | Bacteria | 4917 |
| 82 | Ga0466656_231891 | 3300042550 | Bacteria | 1224 |
| 83 | Ga0466699_010805 | 3300042597 | Bacteria | 4982 |
| 84 | Nasutiter_Contig17532 | 2030936001 | Bacteria | 1214 |
| 85 | JGI24698J34947_10050996 | 3300002449 | Bacteria | 2084 |
| 86 | JGI24695J34938_10005338 | 3300002450 | Bacteria | 8038 |
| 87 | JGI24702J35022_10028442 | 3300002462 | Bacteria | 3004 |
| 88 | Ga0466732_061335 | 3300042656 | Bacteria | 1120 |
| 89 | Ga0123356_10645892 | 3300010049 | Bacteria | 1225 |
| 90 | Ga0466712_045100 | 3300042614 | Bacteria | 1271 |
| 91 | Ga0466726_324632 | 3300042619 | Bacteria | 1329 |
| 92 | Ga0157631_116944 | 3300013007 | Bacteria | 6046 |
| 93 | Ga0415639_010511 | 3300038395 | Bacteria | 18297 |
| 94 | Ga0456237_0015858 | 3300041968 | Bacteria | 1066 |
| 95 | Ga0466694_150170 | 3300042594 | Bacteria | 2931 |
| 96 | Ga0466699_261160 | 3300042597 | Bacteria | 4151 |
| 97 | Ga0466699_341438 | 3300042597 | Bacteria | 4569 |
| 98 | AustNasuHG_c1025850 | 3300000089 | Bacteria | 1839 |
| 99 | JGI24698J34947_10245994 | 3300002449 | Bacteria | 671 |
| 100 | JGI24695J34938_10000101 | 3300002450 | Bacteria | 74732 |
| 101 | JGI24695J34938_10001346 | 3300002450 | Bacteria | 21222 |
| 102 | Ga0123356_10124772 | 3300010049 | Bacteria | 2511 |
| 103 | Ga0466712_000496 | 3300042614 | Bacteria | 29536 |
| 104 | Ga0466712_050574 | 3300042614 | Bacteria | 11299 |
| 105 | Ga0466720_135567 | 3300042607 | Unclassified | 1394 |
| 106 | Ga0466721_396694 | 3300042608 | Bacteria | 1707 |
| 107 | Ga0264413_118717 | 3300024493 | Bacteria | 10216 |
| 108 | Ga0466692_048013 | 3300042591 | Bacteria | 6513 |
| 109 | Ga0466693_264758 | 3300042592 | Bacteria | 2611 |
| 110 | Ga0466694_341905 | 3300042594 | Bacteria | 1688 |
| 111 | Ga0466699_002543 | 3300042597 | Bacteria | 5855 |
| 112 | Ga0466699_101394 | 3300042597 | Bacteria | 20069 |
| 113 | Ga0466731_060100 | 3300042622 | Bacteria | 1145 |
| 114 | JGI24695J34938_10000074 | 3300002450 | Bacteria | 84540 |
| 115 | JGI24695J34938_10001301 | 3300002450 | Bacteria | 21804 |
| 116 | JGI24695J34938_10001483 | 3300002450 | Bacteria | 19815 |
| 117 | Ga0072941_1004603 | 3300005201 | Bacteria | 5713 |
| 118 | Ga0466732_206856 | 3300042656 | Bacteria | 1704 |
| 119 | Ga0123356_10039233 | 3300010049 | Bacteria | 4412 |
| 120 | Ga0123356_13910952 | 3300010049 | Bacteria | 514 |
| 121 | Ga0466712_071084 | 3300042614 | Bacteria | 7633 |
| 122 | Ga0466712_212568 | 3300042614 | Bacteria | 8855 |
| 123 | Ga0466712_215775 | 3300042614 | Bacteria | 1184 |
| 124 | Ga0466712_249762 | 3300042614 | Bacteria | 2234 |
| 125 | Ga0466712_257034 | 3300042614 | Unclassified | 2313 |
| 126 | Ga0466718_005499 | 3300042617 | Bacteria | 1126 |
| 127 | Ga0466718_026296 | 3300042617 | Bacteria | 10965 |
| 128 | Ga0466718_033281 | 3300042617 | Bacteria | 35431 |
| 129 | Ga0466718_100451 | 3300042617 | Bacteria | 3896 |
| 130 | Ga0466720_025838 | 3300042607 | Bacteria | 8963 |
| 131 | Ga0466698_459986 | 3300042610 | Bacteria | 2042 |
| 132 | Ga0264413_117634 | 3300024493 | Bacteria | 1504 |
| 133 | Ga0466693_389927 | 3300042592 | Bacteria | 13494 |
| 134 | Ga0466699_008216 | 3300042597 | Bacteria | 10045 |
| 135 | Ga0466699_021544 | 3300042597 | Bacteria | 70828 |
| 136 | Ga0466699_068154 | 3300042597 | Bacteria | 4366 |
| 137 | Ga0466731_065591 | 3300042622 | Bacteria | 30138 |
| 138 | JGI24698J34947_10005751 | 3300002449 | Bacteria | 6801 |
| 139 | JGI24698J34947_10043731 | 3300002449 | Bacteria | 2295 |
| 140 | JGI24698J34947_10118895 | 3300002449 | Bacteria | 1151 |
| 141 | JGI24695J34938_10000426 | 3300002450 | Bacteria | 40565 |
| 142 | JGI24695J34938_10000569 | 3300002450 | Bacteria | 35542 |
| 143 | JGI24695J34938_10055785 | 3300002450 | Bacteria | 1706 |
| 144 | Ga0072940_1003635 | 3300005200 | Unclassified | 2416 |
| 145 | Ga0072940_1061332 | 3300005200 | Unclassified | 1357 |
| 146 | Ga0072941_1023125 | 3300005201 | Bacteria | 10142 |
| 147 | Ga0074263_108730 | 3300005485 | Unclassified | 2719 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.