Protein Family IF03943
Metagenome
Isolate
374
Members
236
Samples
222
Scaffolds
415.55
Avg Length
Representative Sequence
- ID
- 3300012847|Ga0160445_100138|Ga0160445_10013816
- Length
- 462 aa
- Sequence
- MNIKFRLTLMSFMQFFVWGAWLITIANYWFGTKQWDGAQFGLIFATMGFASLFMPTITGIIADKWINAEKLYAILHILYACTLIYIPQVETPNAFFWTIFLAMCFYMPTISLSNSISYSTLKSNNLDLVKDFPPIRVWGTIGFIAAMWMTNLTESKASANQFYIAGIGALALGIYAFSLPKCPPSNSLEEKSTLMQKFGLDAFKLFANYKMALFFVFSMFLGGALQLTNAYGDVFLDEFKLLPVYAESFVIKYSTIIMSISQVSETLFILAIPFFLKRFGIKKVMVIAMLAWVFRFGLFAYGDPSGNLWMIILSCVVYGMAFDFFNISGSLFVETSTTPKTRSSAQGLFMMMTNGFGAVLGSVISGWMIQKYFTESYTNIQALAAHVNATSTDKHLLNFLSEKGISVLENGNLSRALDVKDWHNIWLAFTIYALIITVLFMIFFKHKHTKAQEKAIEAITH*
Sample Types
Isolate
40.6%
Metagenome
59.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
47.1%
Unclassified
10.7%
Termitidae
10.7%
Kalotermitidae
6.2%
Elmidae
4.4%
Culicidae
4.0%
Formicidae
2.7%
Rhinotermitidae
2.2%
Drosophilidae
2.2%
Sarcophagidae
1.3%
Hydrophilidae
1.3%
Passalidae
1.3%
Armadillidiidae
1.3%
Termopsidae
1.3%
Blattidae
0.9%
Daphniidae
0.4%
Hodotermitidae
0.4%
Cerambycidae
0.4%
Bombycidae
0.4%
Cambaridae
0.4%
Taxonomy
Archaea
0
Bacteria
356
Eukaryota
0
Viruses
0
Unclassified
18
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2756170265 | Gilliamella apicola DSM 104097 | Isolate | Unclassified |
| 2 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 3 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 4 | 2831380896 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 5 | 2834098943 | Gilliamella apis NO3 | Isolate | Apidae |
| 6 | 2843337836 | Gilliamella apicola N-12-12 | Isolate | Apidae |
| 7 | 2846480698 | Gilliamella apis N-G4 | Isolate | Apidae |
| 8 | 2846488152 | Gilliamella apicola Bim3-2 | Isolate | Apidae |
| 9 | 2849449383 | Gilliamella apicola WF3-4 | Isolate | Apidae |
| 10 | 2849458003 | Gilliamella apicola HK7 | Isolate | Apidae |
| 11 | 2849463436 | Gilliamella apicola A-8-12 | Isolate | Apidae |
| 12 | 2857876020 | Gilliamella apicola Nev6-6 | Isolate | Apidae |
| 13 | 2857881114 | Gilliamella apis N-G3 | Isolate | Apidae |
| 14 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 15 | 2868494745 | Gilliamella apis NO1 | Isolate | Apidae |
| 16 | 2870902796 | Gilliamella apicola GillExp13 | Isolate | Apidae |
| 17 | 2870915472 | Gilliamella apis A-TSA3 | Isolate | Apidae |
| 18 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 19 | 2873656248 | Gilliamella apicola A-1-24 | Isolate | Apidae |
| 20 | 2876016455 | Gilliamella apicola N6 | Isolate | Apidae |
| 21 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 22 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 23 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 24 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 25 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 26 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 27 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 28 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 29 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 30 | 8088486376 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 31 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 32 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 33 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 34 | 2515154047 | Candidatus Gilliamella apicola wkB1 | Isolate | Apidae |
| 35 | 2684622921 | Frischella perrara Fp_167 | Isolate | Unclassified |
| 36 | 2684622923 | Gilliamella apicola Ga_172 | Isolate | Unclassified |
| 37 | 2684622925 | Gilliamella apicola Ga_178 | Isolate | Unclassified |
| 38 | 2684622926 | Gilliamella apicola Ga_182 | Isolate | Unclassified |
| 39 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 40 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 41 | 2772190890 | Unclassified Elusimicrobia Lab288P4_bin46 | Isolate | Unclassified |
| 42 | 2832343623 | Apibacter adventoris wkB180 | Isolate | Apidae |
| 43 | 2833532623 | Frischella perrara ESL0167 | Isolate | Apidae |
| 44 | 2840795165 | Gilliamella apicola N-22 | Isolate | Apidae |
| 45 | 2846483029 | Gilliamella apis AM1 | Isolate | Apidae |
| 46 | 2849466174 | Gilliamella apis P83G | Isolate | Apidae |
| 47 | 2854144746 | Gilliamella apicola NO6 | Isolate | Apidae |
| 48 | 2854149989 | Gilliamella apis A-TSA1 | Isolate | Apidae |
| 49 | 2857870431 | Gilliamella apicola A-7-24 | Isolate | Apidae |
| 50 | 2857873190 | Gilliamella apicola Nev5-1 | Isolate | Apidae |
| 51 | 2857886120 | Gilliamella apicola Bim1-2 | Isolate | Apidae |
| 52 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 53 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 54 | 2868492035 | Gilliamella apicola Occ4-3 | Isolate | Apidae |
| 55 | 2876019154 | Gilliamella apicola ESL0182 | Isolate | Apidae |
| 56 | 2876030618 | Gilliamella apicola HK2 | Isolate | Apidae |
| 57 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 58 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 59 | 3300000472 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-B02 | Metagenome | Apidae |
| 60 | 3300000473 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-I20 | Metagenome | Apidae |
| 61 | 3300000490 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-L16 | Metagenome | Apidae |
| 62 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 63 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 64 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 65 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 66 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 67 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 68 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 69 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 70 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 71 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 72 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 73 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 74 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 75 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 76 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 77 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 78 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 79 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 80 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 81 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 82 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Apidae |
| 83 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 84 | 2840797934 | Gilliamella apicola Choc5-1 | Isolate | Apidae |
| 85 | 2846472545 | Gilliamella sp. N-W3 | Isolate | Apidae |
| 86 | 2846475167 | Gilliamella apicola N-G5 | Isolate | Apidae |
| 87 | 2846493360 | Gilliamella apis N-G1 | Isolate | Apidae |
| 88 | 2854132136 | Gilliamella apicola wkB292 | Isolate | Apidae |
| 89 | 2857888719 | Gilliamella apicola N-15-12 | Isolate | Apidae |
| 90 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 91 | 2870908367 | Gilliamella apis NO13 | Isolate | Apidae |
| 92 | 2870910722 | Gilliamella apicola wkB112 | Isolate | Apidae |
| 93 | 2873648542 | Gilliamella apicola NO10 | Isolate | Apidae |
| 94 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 95 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 96 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 97 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 98 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 99 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 100 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 101 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 102 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 103 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 104 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 105 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 106 | 2515154034 | Frischella perrara PEB0191 | Isolate | Apidae |
| 107 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 108 | 2630968947 | Frischella perrara PEB0191 | Isolate | Apidae |
| 109 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 110 | 2785510744 | Gilliamella sp. ESL0405 | Isolate | Apidae |
| 111 | 2785510745 | Gilliamella sp. ESL0407 | Isolate | Apidae |
| 112 | 2832372155 | Apibacter adventoris wkB301 | Isolate | Apidae |
| 113 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 114 | 2843334863 | Gilliamella apicola A-2-24 | Isolate | Apidae |
| 115 | 2846490831 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 116 | 2849446820 | Gilliamella apicola Bif1-4 | Isolate | Apidae |
| 117 | 2849468476 | Gilliamella apicola N-28 | Isolate | Apidae |
| 118 | 2854129949 | Gilliamella apis M1-2G | Isolate | Apidae |
| 119 | 2854137290 | Gilliamella apicola Imp1-6 | Isolate | Apidae |
| 120 | 2854139540 | Gilliamella apicola Imp1-1 | Isolate | Apidae |
| 121 | 2857883421 | Gilliamella apicola N2 | Isolate | Apidae |
| 122 | 2857891623 | Gilliamella apicola wkB171 | Isolate | Apidae |
| 123 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 124 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 125 | 2868486652 | Gilliamella sp. N-G2 | Isolate | Apidae |
| 126 | 2868506828 | Gilliamella apicola App4-10 | Isolate | Apidae |
| 127 | 2870897478 | Gilliamella apicola A-7-12 | Isolate | Apidae |
| 128 | 2870900452 | Gilliamella apis NO14 | Isolate | Apidae |
| 129 | 2873640908 | Gilliamella apicola wkB308 | Isolate | Apidae |
| 130 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 131 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 132 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 133 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 134 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 135 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 136 | 2684622924 | Gilliamella apicola Ga_177 | Isolate | Unclassified |
| 137 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 138 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 139 | 2832298047 | Apibacter sp. wkB309 | Isolate | Apidae |
| 140 | 2838840603 | Gilliamella apicola A-9-12 | Isolate | Apidae |
| 141 | 2846477985 | Gilliamella apicola Fer1-1 | Isolate | Apidae |
| 142 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 143 | 2849460838 | Gilliamella apicola Gris3-2 | Isolate | Apidae |
| 144 | 2857868033 | Gilliamella apis P62G | Isolate | Apidae |
| 145 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 146 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 147 | 2864899338 | Mycobacteroides chelonae S00154 | Isolate | Elmidae |
| 148 | 2868497104 | Gilliamella apis A-TSA4 | Isolate | Apidae |
| 149 | 2870905362 | Gilliamella apicola Nev3-1 | Isolate | Apidae |
| 150 | 2873645950 | Gilliamella apicola Fer2-1 | Isolate | Apidae |
| 151 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 152 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 153 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 154 | 8065340634 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 155 | 8088488961 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 156 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 157 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 158 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 159 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 160 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 161 | 2684622922 | Gilliamella apicola Ga_169 | Isolate | Unclassified |
| 162 | 2756170266 | Frischella perrara DSM 104328 | Isolate | Unclassified |
| 163 | 2785510746 | Gilliamella sp. ESL0441 | Isolate | Apidae |
| 164 | 2785510747 | Gilliamella sp. ESL0443 | Isolate | Apidae |
| 165 | 2799112231 | Apibacter sp. ESL0432 | Isolate | Unclassified |
| 166 | 2820736622 | Unclassified Bacteroidetes Th196P4bin26 | Isolate | Unclassified |
| 167 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 168 | 2837615801 | Gilliamella apicola ESL0177 | Isolate | Apidae |
| 169 | 2846485327 | Gilliamella apicola AM4 | Isolate | Apidae |
| 170 | 2849471304 | Gilliamella apicola NO5 | Isolate | Apidae |
| 171 | 2873643457 | Gilliamella apis A-4-12 | Isolate | Apidae |
| 172 | 2876011797 | Gilliamella apis NO16 | Isolate | Apidae |
| 173 | 2876022486 | Gilliamella apicola A8 | Isolate | Apidae |
| 174 | 2876027665 | Gilliamella apicola P54G | Isolate | Apidae |
| 175 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 176 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 177 | 3300000462 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Frischia SCG AB-598-I22 | Metagenome | Apidae |
| 178 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 179 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 180 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 181 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 182 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 183 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 184 | 8088491222 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 185 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 186 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 187 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 188 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 189 | 2513237114 | Ignatzschineria larvae DSM 13226 | Isolate | Sarcophagidae |
| 190 | 2515154049 | Candidatus Gilliamella apicola wkB30 | Isolate | Apidae |
| 191 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 192 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 193 | 2854141978 | Gilliamella apicola A-12-12 | Isolate | Apidae |
| 194 | 2854147632 | Gilliamella apicola wkB195 | Isolate | Apidae |
| 195 | 2857878760 | Gilliamella apicola Gris1-4 | Isolate | Apidae |
| 196 | 2868489326 | Gilliamella apicola N10 | Isolate | Apidae |
| 197 | 2868499409 | Gilliamella apicola N-9-4 | Isolate | Apidae |
| 198 | 2870913170 | Gilliamella apis A-TSA2 | Isolate | Apidae |
| 199 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 200 | 2873633977 | Gilliamella apicola wkB178 | Isolate | Apidae |
| 201 | 2873638493 | Gilliamella apicola wkB72 | Isolate | Apidae |
| 202 | 2876025319 | Gilliamella apis NO12 | Isolate | Apidae |
| 203 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
| 204 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 205 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 206 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 207 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 208 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 209 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 210 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 211 | 8088493931 | Gilliamella apis K-MP18 | Isolate | Apidae |
| 212 | 642555127 | Elusimicrobium minutum Pei191 | Isolate | Unclassified |
| 213 | 2785510743 | Apibacter sp. ESL0404 | Isolate | Apidae |
| 214 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 215 | 2837618715 | Gilliamella apicola Aw-17 | Isolate | Apidae |
| 216 | 2841195917 | Gilliamella apicola wkB7 | Isolate | Apidae |
| 217 | 2846495668 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 218 | 2849452216 | Gilliamella apicola AW11 | Isolate | Apidae |
| 219 | 2849455045 | Gilliamella apicola NO8 | Isolate | Apidae |
| 220 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 221 | 2868504459 | Gilliamella apis NO4 | Isolate | Apidae |
| 222 | 2870917785 | Gilliamella apis NO15 | Isolate | Apidae |
| 223 | 2873636219 | Gilliamella apicola App2-1 | Isolate | Apidae |
| 224 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 225 | 2876033458 | Gilliamella apicola AM6 | Isolate | Apidae |
| 226 | 2878462549 | Gilliamella apicola Occ3-1 | Isolate | Apidae |
| 227 | 2878464769 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 228 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 229 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 230 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 231 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 232 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 233 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 234 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 235 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 236 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_150127 | 3300042611 | Bacteria | 16959 |
| 2 | Ga0466732_127076 | 3300042656 | Bacteria | 4751 |
| 3 | Ga0466733_176979 | 3300042659 | Bacteria | 34183 |
| 4 | Ga0123357_10043868 | 3300009784 | Bacteria | 6072 |
| 5 | Ga0123354_10047780 | 3300010882 | Bacteria | 6517 |
| 6 | Ga0160464_100251 | 3300012805 | Bacteria | 50559 |
| 7 | Ga0466715_024930 | 3300042616 | Bacteria | 21877 |
| 8 | Ga0466715_056477 | 3300042616 | Bacteria | 4130 |
| 9 | Ga0466715_084192 | 3300042616 | Bacteria | 39268 |
| 10 | Ga0466715_596057 | 3300042616 | Bacteria | 23706 |
| 11 | Ga0466701_053030 | 3300042598 | Bacteria | 11416 |
| 12 | Ga0466701_069497 | 3300042598 | Bacteria | 65045 |
| 13 | Ga0466717_039129 | 3300042604 | Bacteria | 3215 |
| 14 | Ga0466716_092980 | 3300042605 | Bacteria | 25359 |
| 15 | Ga0466722_026330 | 3300042609 | Bacteria | 6601 |
| 16 | Ga0466657_097341 | 3300042582 | Bacteria | 1915 |
| 17 | Ga0466691_004536 | 3300042593 | Bacteria | 19096 |
| 18 | Ga0466691_029991 | 3300042593 | Bacteria | 8445 |
| 19 | Ga0466694_400694 | 3300042594 | Bacteria | 3261 |
| 20 | Ga0466696_244663 | 3300042596 | Bacteria | 1690 |
| 21 | JGI24705J35276_12230883 | 3300002504 | Bacteria | 3765 |
| 22 | Ga0103265_1000009 | 3300007068 | Bacteria | 143391 |
| 23 | Ga0104045_1019203 | 3300007085 | Bacteria | 15886 |
| 24 | Ga0104019_1002135 | 3300007150 | Bacteria | 7378 |
| 25 | Ga0466730_081936 | 3300042625 | Bacteria | 13722 |
| 26 | Ga0466709_077519 | 3300042648 | Bacteria | 9059 |
| 27 | Ga0466724_61209 | 3300042649 | Bacteria | 46468 |
| 28 | Ga0466727_331140 | 3300042655 | Bacteria | 10550 |
| 29 | Ga0123357_10010605 | 3300009784 | Bacteria | 11740 |
| 30 | Ga0123353_10000594 | 3300010167 | Bacteria | 44270 |
| 31 | Ga0123353_10012581 | 3300010167 | Bacteria | 12045 |
| 32 | Ga0466701_046955 | 3300042598 | Bacteria | 14289 |
| 33 | Ga0466706_006525 | 3300042599 | Bacteria | 36305 |
| 34 | Ga0466713_046146 | 3300042602 | Bacteria | 21457 |
| 35 | Ga0466713_084269 | 3300042602 | Bacteria | 58503 |
| 36 | Ga0466722_009584 | 3300042609 | Bacteria | 5493 |
| 37 | Ga0466722_228493 | 3300042609 | Bacteria | 4130 |
| 38 | Ga0466656_009937 | 3300042550 | Bacteria | 14650 |
| 39 | Ga0466690_059027 | 3300042590 | Bacteria | 15450 |
| 40 | Ga0466692_120097 | 3300042591 | Bacteria | 76506 |
| 41 | Ga0466699_356531 | 3300042597 | Bacteria | 3183 |
| 42 | gam1t_NODE_123321_length=7975_GC=33_3_Contigs=3 | 2189573031 | Bacteria | 7995 |
| 43 | 2227119709 | 2225789004 | Bacteria | 9187 |
| 44 | JGI24705J35276_12209723 | 3300002504 | Bacteria | 1805 |
| 45 | Ga0068305_10871989 | 3300005083 | Bacteria | 2035 |
| 46 | Ga0074278_150247 | 3300005721 | Unclassified | 3958 |
| 47 | Ga0104041_1001266 | 3300007106 | Bacteria | 6575 |
| 48 | Ga0104048_1004222 | 3300007143 | Unclassified | 8578 |
| 49 | Ga0103268_1000022 | 3300007192 | Bacteria | 48958 |
| 50 | Ga0466731_022859 | 3300042622 | Bacteria | 2872 |
| 51 | Ga0466734_092523 | 3300042623 | Bacteria | 3644 |
| 52 | Ga0466704_262004 | 3300042643 | Bacteria | 8800 |
| 53 | Ga0466709_105464 | 3300042648 | Bacteria | 22179 |
| 54 | Ga0466724_00918 | 3300042649 | Bacteria | 46721 |
| 55 | Ga0466708_022605 | 3300042652 | Bacteria | 22414 |
| 56 | Ga0466732_183758 | 3300042656 | Bacteria | 1741 |
| 57 | Ga0123356_10477899 | 3300010049 | Bacteria | 1399 |
| 58 | Ga0123353_10139749 | 3300010167 | Bacteria | 3880 |
| 59 | Ga0123354_10128216 | 3300010882 | Bacteria | 3225 |
| 60 | Ga0160442_100047 | 3300012806 | Bacteria | 180728 |
| 61 | Ga0466710_259934 | 3300042613 | Bacteria | 1750 |
| 62 | Ga0466715_192170 | 3300042616 | Bacteria | 3898 |
| 63 | Ga0466726_203498 | 3300042619 | Bacteria | 2368 |
| 64 | Ga0466701_052644 | 3300042598 | Bacteria | 25675 |
| 65 | Ga0466713_057482 | 3300042602 | Bacteria | 5077 |
| 66 | Ga0466719_155643 | 3300042606 | Bacteria | 5717 |
| 67 | Ga0160455_100035 | 3300012837 | Bacteria | 309778 |
| 68 | Ga0160472_100817 | 3300012839 | Unclassified | 12936 |
| 69 | Ga0466690_185956 | 3300042590 | Bacteria | 8690 |
| 70 | IMNBL1DRAFT_c0011535 | 3300000062 | Bacteria | 4121 |
| 71 | HBC_ctgsDRAFT_1000049 | 3300000333 | Bacteria | 29797 |
| 72 | SCG598B02_11650 | 3300000472 | Unclassified | 10192 |
| 73 | SCG598I20_11598 | 3300000473 | Unclassified | 59018 |
| 74 | JGI24702J35022_10014712 | 3300002462 | Unclassified | 4312 |
| 75 | JGI24702J35022_10045203 | 3300002462 | Bacteria | 2346 |
| 76 | JGI24696J40584_12961693 | 3300002834 | Bacteria | 37831 |
| 77 | Ga0072941_1039637 | 3300005201 | Bacteria | 2161 |
| 78 | Ga0103267_1000067 | 3300007190 | Bacteria | 50346 |
| 79 | Ga0103267_1000512 | 3300007190 | Bacteria | 11732 |
| 80 | Ga0123357_10000105 | 3300009784 | Bacteria | 69766 |
| 81 | Ga0466735_191060 | 3300042624 | Bacteria | 1616 |
| 82 | Ga0466703_167241 | 3300042636 | Bacteria | 9100 |
| 83 | Ga0466704_499034 | 3300042643 | Bacteria | 46935 |
| 84 | Ga0123357_10200042 | 3300009784 | Bacteria | 2276 |
| 85 | Ga0123356_10158307 | 3300010049 | Bacteria | 2258 |
| 86 | Ga0123354_10000012 | 3300010882 | Bacteria | 160905 |
| 87 | Ga0160465_100310 | 3300012803 | Bacteria | 29718 |
| 88 | Ga0466715_309209 | 3300042616 | Bacteria | 44379 |
| 89 | Ga0466714_029794 | 3300042603 | Bacteria | 42861 |
| 90 | Ga0466719_345597 | 3300042606 | Bacteria | 5928 |
| 91 | Ga0466719_405085 | 3300042606 | Bacteria | 19326 |
| 92 | Ga0160441_101750 | 3300012825 | Bacteria | 5640 |
| 93 | Ga0160445_100138 | 3300012847 | Bacteria | 63729 |
| 94 | Ga0466657_311160 | 3300042582 | Bacteria | 5194 |
| 95 | Ga0466657_387007 | 3300042582 | Bacteria | 76676 |
| 96 | gam1t_NODE_510105_length=8553_GC=34_4_Contigs=1 | 2189573031 | Bacteria | 8553 |
| 97 | 2227286358 | 2225789004 | Bacteria | 6750 |
| 98 | IMNBGM34_c001772 | 3300000036 | Bacteria | 3441 |
| 99 | IMNBL1DRAFT_c0005558 | 3300000062 | Unclassified | 7169 |
| 100 | IMNBL1DRAFT_c0009299 | 3300000062 | Bacteria | 4868 |
| 101 | JGI24696J40584_12941552 | 3300002834 | Bacteria | 1712 |
| 102 | Ga0123357_10000088 | 3300009784 | Bacteria | 73731 |
| 103 | Ga0466729_289820 | 3300042621 | Bacteria | 6089 |
| 104 | Ga0466735_069913 | 3300042624 | Bacteria | 19536 |
| 105 | Ga0466735_128481 | 3300042624 | Bacteria | 1961 |
| 106 | Ga0466730_073669 | 3300042625 | Bacteria | 406091 |
| 107 | Ga0466724_12167 | 3300042649 | Unclassified | 3130 |
| 108 | Ga0466724_27355 | 3300042649 | Unclassified | 3106 |
| 109 | Ga0466708_043094 | 3300042652 | Bacteria | 29530 |
| 110 | Ga0123357_10013209 | 3300009784 | Bacteria | 10701 |
| 111 | Ga0123354_10000494 | 3300010882 | Bacteria | 39538 |
| 112 | Ga0123354_10022284 | 3300010882 | Bacteria | 9986 |
| 113 | Ga0466711_023837 | 3300042615 | Bacteria | 62988 |
| 114 | Ga0466715_372499 | 3300042616 | Bacteria | 4250 |
| 115 | Ga0466723_124363 | 3300042618 | Bacteria | 10591 |
| 116 | Ga0466726_003211 | 3300042619 | Bacteria | 5245 |
| 117 | Ga0466726_336356 | 3300042619 | Bacteria | 4101 |
| 118 | Ga0466706_122367 | 3300042599 | Bacteria | 3865 |
| 119 | Ga0466707_152598 | 3300042601 | Bacteria | 11326 |
| 120 | Ga0466707_311642 | 3300042601 | Bacteria | 1688 |
| 121 | Ga0466713_017843 | 3300042602 | Bacteria | 21145 |
| 122 | Ga0160434_100110 | 3300012850 | Bacteria | 47210 |
| 123 | gam1t_NODE_507376_length=3958_GC=32_5_Contigs=1 | 2189573031 | Bacteria | 3958 |
| 124 | JGI24702J35022_10082817 | 3300002462 | Bacteria | 1739 |
| 125 | JGI24696J40584_12949934 | 3300002834 | Bacteria | 2111 |
| 126 | Ga0068305_10014769 | 3300005083 | Bacteria | 1699 |
| 127 | Ga0102736_1000775 | 3300007052 | Bacteria | 6042 |
| 128 | Ga0103267_1000278 | 3300007190 | Bacteria | 33018 |
| 129 | Ga0103267_1004143 | 3300007190 | Unclassified | 4459 |
| 130 | Ga0104147_1101931 | 3300007224 | Bacteria | 4183 |
| 131 | Ga0466731_112162 | 3300042622 | Bacteria | 28550 |
| 132 | Ga0466703_221046 | 3300042636 | Bacteria | 15230 |
| 133 | Ga0466709_102522 | 3300042648 | Bacteria | 172874 |
| 134 | Ga0123357_10139047 | 3300009784 | Bacteria | 2992 |
| 135 | Ga0123353_10084856 | 3300010167 | Bacteria | 5099 |
| 136 | Ga0160465_100198 | 3300012803 | Bacteria | 48589 |
| 137 | Ga0466711_049078 | 3300042615 | Bacteria | 26381 |
| 138 | Ga0466711_329754 | 3300042615 | Bacteria | 36740 |
| 139 | Ga0466715_233761 | 3300042616 | Bacteria | 5495 |
| 140 | Ga0466723_214552 | 3300042618 | Bacteria | 46791 |
| 141 | Ga0466726_454201 | 3300042619 | Bacteria | 5143 |
| 142 | Ga0466728_101145 | 3300042620 | Bacteria | 2811 |
| 143 | Ga0466729_039325 | 3300042621 | Bacteria | 2099 |
| 144 | Ga0466706_225176 | 3300042599 | Bacteria | 38857 |
| 145 | Ga0466706_228381 | 3300042599 | Bacteria | 2136 |
| 146 | Ga0466707_026148 | 3300042601 | Bacteria | 2487 |
| 147 | Ga0466719_156783 | 3300042606 | Bacteria | 3842 |
| 148 | Ga0466719_176923 | 3300042606 | Bacteria | 3903 |
| 149 | Ga0160460_100151 | 3300012845 | Bacteria | 78148 |
| 150 | Ga0466690_408627 | 3300042590 | Bacteria | 146519 |
| 151 | Ga0466691_062030 | 3300042593 | Bacteria | 7486 |
| 152 | Ga0466694_032150 | 3300042594 | Bacteria | 6067 |
| 153 | Ga0466694_041458 | 3300042594 | Bacteria | 1954 |
| 154 | gam1t_NODE_422402_length=5291_GC=34_4_Contigs=8 | 2189573031 | Unclassified | 5361 |
| 155 | gam1t_NODE_603478_length=226970_GC=33_8_Contigs=8 | 2189573031 | Bacteria | 227040 |
| 156 | IMNBL1DRAFT_c0000845 | 3300000062 | Bacteria | 24026 |
| 157 | SCG598I22_12478 | 3300000462 | Unclassified | 21525 |
| 158 | SCG598L16_135044 | 3300000490 | Bacteria | 37816 |
| 159 | JGI24702J35022_10006212 | 3300002462 | Bacteria | 6923 |
| 160 | JGI24696J40584_12961386 | 3300002834 | Bacteria | 14759 |
| 161 | Ga0074278_144901 | 3300005721 | Bacteria | 227040 |
| 162 | Ga0104045_1020040 | 3300007085 | Bacteria | 2428 |
| 163 | Ga0127649_104947 | 3300009460 | Bacteria | 14551 |
| 164 | Ga0123357_10000281 | 3300009784 | Bacteria | 48596 |
| 165 | Ga0123357_10000602 | 3300009784 | Bacteria | 35567 |
| 166 | Ga0466731_181711 | 3300042622 | Bacteria | 2811 |
| 167 | Ga0466735_083052 | 3300042624 | Bacteria | 1274 |
| 168 | Ga0466735_149689 | 3300042624 | Bacteria | 2201 |
| 169 | Ga0466704_161992 | 3300042643 | Bacteria | 55801 |
| 170 | Ga0466727_124960 | 3300042655 | Bacteria | 13419 |
| 171 | Ga0466727_229953 | 3300042655 | Bacteria | 7765 |
| 172 | Ga0466705_045959 | 3300042612 | Bacteria | 6523 |
| 173 | Ga0466733_135349 | 3300042659 | Unclassified | 2454 |
| 174 | Ga0123356_10125736 | 3300010049 | Bacteria | 2502 |
| 175 | Ga0123354_10110583 | 3300010882 | Bacteria | 3632 |
| 176 | Ga0123354_10175995 | 3300010882 | Unclassified | 2466 |
| 177 | Ga0466726_229051 | 3300042619 | Bacteria | 13916 |
| 178 | Ga0466726_454818 | 3300042619 | Bacteria | 17050 |
| 179 | Ga0466728_207928 | 3300042620 | Bacteria | 9257 |
| 180 | Ga0466706_013829 | 3300042599 | Bacteria | 33879 |
| 181 | Ga0466707_165445 | 3300042601 | Bacteria | 13436 |
| 182 | Ga0466707_237717 | 3300042601 | Bacteria | 21796 |
| 183 | Ga0466713_060620 | 3300042602 | Bacteria | 398690 |
| 184 | Ga0466713_094343 | 3300042602 | Bacteria | 28200 |
| 185 | Ga0466716_347549 | 3300042605 | Bacteria | 1226 |
| 186 | Ga0466698_324456 | 3300042610 | Bacteria | 2712 |
| 187 | Ga0160467_100248 | 3300012829 | Bacteria | 66505 |
| 188 | Ga0160459_100023 | 3300012831 | Bacteria | 364187 |
| 189 | Ga0466690_022612 | 3300042590 | Unclassified | 3643 |
| 190 | IMNBGM34_c000263 | 3300000036 | Bacteria | 15171 |
| 191 | JGI24705J35276_12231836 | 3300002504 | Bacteria | 4085 |
| 192 | Ga0074278_128902 | 3300005721 | Unclassified | 5361 |
| 193 | Ga0104050_1001820 | 3300007153 | Bacteria | 13063 |
| 194 | Ga0104050_1006273 | 3300007153 | Unclassified | 19568 |
| 195 | Ga0103264_1000036 | 3300007188 | Bacteria | 135516 |
| 196 | Ga0466725_429822 | 3300042654 | Bacteria | 20393 |
| 197 | Ga0466727_001845 | 3300042655 | Bacteria | 6101 |
| 198 | Ga0466733_090227 | 3300042659 | Bacteria | 1872 |
| 199 | Ga0123356_10052345 | 3300010049 | Bacteria | 3799 |
| 200 | Ga0123354_10308330 | 3300010882 | Bacteria | 1483 |
| 201 | Ga0466711_420566 | 3300042615 | Bacteria | 4093 |
| 202 | Ga0466715_144957 | 3300042616 | Bacteria | 3430 |
| 203 | Ga0466723_071735 | 3300042618 | Bacteria | 6546 |
| 204 | Ga0466707_126978 | 3300042601 | Bacteria | 67227 |
| 205 | Ga0466707_270871 | 3300042601 | Bacteria | 4023 |
| 206 | Ga0466716_146151 | 3300042605 | Bacteria | 11534 |
| 207 | Ga0466690_004037 | 3300042590 | Bacteria | 21035 |
| 208 | Ga0466690_024880 | 3300042590 | Bacteria | 1999 |
| 209 | Ga0466691_106300 | 3300042593 | Bacteria | 20437 |
| 210 | Ga0466696_068707 | 3300042596 | Bacteria | 16286 |
| 211 | Ga0466699_420129 | 3300042597 | Bacteria | 3067 |
| 212 | JGI24702J35022_10000182 | 3300002462 | Bacteria | 33528 |
| 213 | JGI24702J35022_10070559 | 3300002462 | Bacteria | 1881 |
| 214 | Meta3P_1001444 | 3300002464 | Bacteria | 6441 |
| 215 | JGI24696J40584_12954168 | 3300002834 | Bacteria | 2594 |
| 216 | Ga0074278_117221 | 3300005721 | Unclassified | 7995 |
| 217 | Ga0102734_1000010 | 3300007129 | Bacteria | 79566 |
| 218 | Ga0104048_1020035 | 3300007143 | Bacteria | 9341 |
| 219 | Ga0466729_303856 | 3300042621 | Bacteria | 3799 |
| 220 | Ga0466735_037952 | 3300042624 | Bacteria | 5537 |
| 221 | Ga0466730_021757 | 3300042625 | Bacteria | 584842 |
| 222 | Ga0466727_041976 | 3300042655 | Bacteria | 33578 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.