Protein Family IF03913
Metagenome
Isolate
343
Members
264
Samples
116
Scaffolds
198.81
Avg Length
Representative Sequence
- ID
- 3300012846|Ga0160433_100200|Ga0160433_10020030
- Length
- 224 aa
- Sequence
- MQQMPKVGMQPIRRQQLIEATLLAVDQVGLGDASIALIARLAGVSNGIISHYFQDKNGLIAATMRYIMSMLNEGVVARRQALSDDSPRAHLKVIIEGNFDASQVNGPAMKTWLAFWASSMHQPSLHRLQRINDHRLYSNLCCQFRRVLPIAEARTAARGLAALIDGLWLRGALSGDAFDTEQAIRIAYEYMELQLAKQRPDTELQASEPPRSAIVRQTGARRG*
Sample Types
Isolate
66.2%
Metagenome
33.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
27.8%
Unclassified
9.0%
Drosophilidae
8.2%
Anthocoridae
7.8%
Formicidae
7.8%
Curculionidae
7.1%
Muscidae
5.1%
Culicidae
4.7%
Elmidae
3.9%
Calliphoridae
3.5%
Termitidae
2.4%
Apidae
2.0%
Tenebrionidae
2.0%
Tephritidae
1.2%
Armadillidiidae
0.8%
Pentatomidae
0.8%
Sarcophagidae
0.8%
Berytidae
0.8%
Siricidae
0.4%
Crambidae
0.4%
Pteromalidae
0.4%
Thripidae
0.4%
Anthomyiidae
0.4%
Pediculidae
0.4%
Cerambycidae
0.4%
Carabidae
0.4%
Largidae
0.4%
Alydidae
0.4%
Kalotermitidae
0.4%
Taxonomy
Archaea
0
Bacteria
304
Eukaryota
0
Viruses
0
Unclassified
39
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 2 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 3 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 4 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 5 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 6 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 7 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 8 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 9 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 10 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 11 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 12 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 13 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 14 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 15 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 16 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 17 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 18 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 19 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 20 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 21 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 22 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 23 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 24 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 25 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 26 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 27 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 28 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 29 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 30 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 31 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 32 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 33 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 34 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 35 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 36 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 37 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 38 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 39 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 40 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 41 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 42 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 43 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 44 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 45 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 46 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 47 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 48 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 49 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 50 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 51 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 52 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 53 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 54 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 55 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 56 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 57 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 58 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 59 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 60 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 61 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 62 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 63 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 64 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 65 | 2864840607 | Acinetobacter johnsonii S00071 | Isolate | Elmidae |
| 66 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 67 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 68 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 69 | 2972038244 | Pseudomonas sp. DS1 | Isolate | Formicidae |
| 70 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 71 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 72 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 73 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 74 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 75 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 76 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 77 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 78 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
| 79 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 80 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 81 | 2687453756 | Pseudomonadales bacterium Cag32 | Isolate | Unclassified |
| 82 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 83 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 84 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 85 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 86 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 87 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 88 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 89 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 90 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 91 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 92 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 93 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 94 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 95 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 96 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 97 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 98 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 99 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 100 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 101 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 102 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 103 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 104 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 105 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 106 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 107 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 108 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 109 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 110 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 111 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 112 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 113 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 114 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 115 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 116 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 117 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 118 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 119 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 120 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 121 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 122 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 123 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 124 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 125 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 126 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 127 | 2864843793 | Acinetobacter johnsonii S00075 | Isolate | Elmidae |
| 128 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 129 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 130 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 131 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 132 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 133 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 134 | 2958255616 | Serratia marcescens TM | Isolate | |
| 135 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 136 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 137 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 138 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 139 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 140 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 141 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 142 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 143 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 144 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 145 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 146 | 2603880173 | Pseudomonas SP. | Isolate | Unclassified |
| 147 | 2687453755 | Pseudomonadales bacterium Cag27 | Isolate | Unclassified |
| 148 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 149 | 641522603 | Acinetobacter baumannii SDF | Isolate | Pediculidae |
| 150 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 151 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 152 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 153 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 154 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 155 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 156 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 157 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 158 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 159 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 160 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 161 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 162 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 163 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 164 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 165 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 166 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 167 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 168 | 2864804954 | Acinetobacter johnsonii S00050 | Isolate | Elmidae |
| 169 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 170 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 171 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 172 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 173 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 174 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 175 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 176 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 177 | 3006190525 | Acinetobacter sp. S54 | Isolate | Curculionidae |
| 178 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 179 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 180 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 181 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 182 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 183 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 184 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 185 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 186 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 187 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 188 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 189 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 190 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 191 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 192 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 193 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 194 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 195 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 196 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 197 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 198 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 199 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 200 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 201 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 202 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 203 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 204 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 205 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 206 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 207 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 208 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 209 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 210 | 3300007136 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 4 gut | Metagenome | Drosophilidae |
| 211 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 212 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 213 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 214 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 215 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 216 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 217 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 218 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 219 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 220 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 221 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 222 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 223 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 224 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 225 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 226 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 227 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 228 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 229 | 2864863795 | Acinetobacter johnsonii S00116 | Isolate | Elmidae |
| 230 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 231 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 232 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 233 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 234 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 235 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 236 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 237 | 3006156446 | Acinetobacter baretiae B10A | Isolate | Apidae |
| 238 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 239 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 240 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 241 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 242 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 243 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 244 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 245 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 246 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 247 | 2687453754 | Pseudomonadales bacterium Cag26 | Isolate | Unclassified |
| 248 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 249 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 250 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 251 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 252 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 253 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 254 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 255 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 256 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 257 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 258 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 259 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 260 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 261 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 262 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 263 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 264 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0160447_101371 | 3300012849 | Unclassified | 9557 |
| 2 | Ga0160436_1016882 | 3300012861 | Unclassified | 1450 |
| 3 | Ga0466713_014081 | 3300042602 | Bacteria | 234884 |
| 4 | Ga0466730_000896 | 3300042625 | Bacteria | 1356 |
| 5 | Ga0466730_082332 | 3300042625 | Bacteria | 6475 |
| 6 | Ga0466725_119246 | 3300042654 | Bacteria | 4058 |
| 7 | DPOL_contig06450 | 2035918003 | Bacteria | 1180 |
| 8 | FGTW_contig33001 | 2065487013 | Unclassified | 1922 |
| 9 | HBC_ctgsDRAFT_1009175 | 3300000333 | Bacteria | 2346 |
| 10 | CVPL005W_1009246 | 3300002934 | Unclassified | 1656 |
| 11 | Ga0103266_1000124 | 3300007067 | Bacteria | 26330 |
| 12 | Ga0104041_1002451 | 3300007106 | Unclassified | 6457 |
| 13 | Ga0103268_1000468 | 3300007192 | Bacteria | 12452 |
| 14 | Ga0103268_1002880 | 3300007192 | Bacteria | 3712 |
| 15 | Ga0160465_100363 | 3300012803 | Bacteria | 25628 |
| 16 | Ga0160453_100577 | 3300012814 | Unclassified | 25252 |
| 17 | Ga0160467_102241 | 3300012829 | Bacteria | 4637 |
| 18 | Ga0160433_100200 | 3300012846 | Bacteria | 48402 |
| 19 | Ga0160435_1000434 | 3300012857 | Bacteria | 14325 |
| 20 | Ga0160436_1004913 | 3300012861 | Bacteria | 3156 |
| 21 | Ga0466701_063769 | 3300042598 | Bacteria | 151198 |
| 22 | SWWA_contig32505__length_1273___numreads_25 | 2100351016 | Bacteria | 1273 |
| 23 | CVPL010L_1000283 | 3300002932 | Unclassified | 13180 |
| 24 | Ga0103260_1000351 | 3300007139 | Bacteria | 9217 |
| 25 | Ga0103260_1001478 | 3300007139 | Unclassified | 4200 |
| 26 | Ga0102740_1002044 | 3300007140 | Unclassified | 7192 |
| 27 | Ga0103264_1000164 | 3300007188 | Bacteria | 38481 |
| 28 | Ga0103264_1000384 | 3300007188 | Bacteria | 24020 |
| 29 | Ga0103267_1028257 | 3300007190 | Bacteria | 1870 |
| 30 | Ga0105553_1018467 | 3300007767 | Unclassified | 5023 |
| 31 | Ga0160467_101220 | 3300012829 | Unclassified | 11649 |
| 32 | Ga0466701_092881 | 3300042598 | Bacteria | 1172 |
| 33 | Ga0466713_064612 | 3300042602 | Bacteria | 2667 |
| 34 | Ga0466730_038303 | 3300042625 | Bacteria | 6932 |
| 35 | Ga0466730_081934 | 3300042625 | Bacteria | 1783 |
| 36 | Ga0466724_64720 | 3300042649 | Unclassified | 9652 |
| 37 | CVPL010W_10000003 | 3300002931 | Bacteria | 118695 |
| 38 | CVPL010W_10000815 | 3300002931 | Bacteria | 35180 |
| 39 | CVPL005W_1000911 | 3300002934 | Bacteria | 9494 |
| 40 | Ga0104042_1123405 | 3300007130 | Bacteria | 1439 |
| 41 | Ga0104044_1020226 | 3300007136 | Unclassified | 2273 |
| 42 | Ga0102740_1000001 | 3300007140 | Bacteria | 144366 |
| 43 | Ga0102737_1017408 | 3300007142 | Bacteria | 1133 |
| 44 | Ga0104040_1149057 | 3300007149 | Bacteria | 1285 |
| 45 | Ga0160459_102089 | 3300012831 | Unclassified | 3482 |
| 46 | Ga0466701_028580 | 3300042598 | Bacteria | 18128 |
| 47 | Ga0466730_038260 | 3300042625 | Unclassified | 3441 |
| 48 | Ga0466730_038563 | 3300042625 | Unclassified | 97380 |
| 49 | Ga0466724_31803 | 3300042649 | Bacteria | 19762 |
| 50 | Ga0466724_36510 | 3300042649 | Bacteria | 2804 |
| 51 | Ga0466725_043776 | 3300042654 | Bacteria | 6765 |
| 52 | FGTW_contig26805 | 2065487013 | Unclassified | 30361 |
| 53 | FGTW_contig33186 | 2065487013 | Unclassified | 1762 |
| 54 | SWWA_contig31643__length_39767___numreads_2414 | 2100351016 | Bacteria | 39767 |
| 55 | Meta3P_1001557 | 3300002464 | Unclassified | 3849 |
| 56 | Ga0063521_1000006 | 3300003973 | Bacteria | 230945 |
| 57 | Ga0102736_1000770 | 3300007052 | Bacteria | 6055 |
| 58 | Ga0103265_1000299 | 3300007068 | Bacteria | 8241 |
| 59 | Ga0102739_1000514 | 3300007095 | Unclassified | 7755 |
| 60 | Ga0105005_1042976 | 3300007505 | Unclassified | 11724 |
| 61 | Ga0160460_100928 | 3300012845 | Unclassified | 12477 |
| 62 | Ga0265387_1000656 | 3300024582 | Bacteria | 5344 |
| 63 | Ga0466701_021959 | 3300042598 | Bacteria | 104761 |
| 64 | Ga0466701_033267 | 3300042598 | Bacteria | 1669 |
| 65 | FGTW_contig27111 | 2065487013 | Unclassified | 1371 |
| 66 | SWWA_contig24645__length_2599___numreads_38 | 2100351016 | Unclassified | 2599 |
| 67 | CVPL010W_10004945 | 3300002931 | Bacteria | 14542 |
| 68 | Ga0074188_1000412 | 3300005318 | Bacteria | 30301 |
| 69 | Ga0103263_106911 | 3300007042 | Bacteria | 1237 |
| 70 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 71 | Ga0265387_1000032 | 3300024582 | Bacteria | 53128 |
| 72 | Ga0255572_1000003 | 3300026175 | Bacteria | 262489 |
| 73 | Ga0466713_148277 | 3300042602 | Bacteria | 181035 |
| 74 | Ga0466730_019320 | 3300042625 | Bacteria | 147177 |
| 75 | Ga0466730_054947 | 3300042625 | Bacteria | 59975 |
| 76 | Ga0466724_17617 | 3300042649 | Unclassified | 2803 |
| 77 | DPOL_contig02480 | 2035918003 | Bacteria | 30675 |
| 78 | Meta3P_1000328 | 3300002464 | Bacteria | 80534 |
| 79 | Meta3P_1001554 | 3300002464 | Bacteria | 12775 |
| 80 | CVPL010W_10009178 | 3300002931 | Bacteria | 9071 |
| 81 | CVPL010L_1002714 | 3300002932 | Unclassified | 3426 |
| 82 | Ga0102738_1000010 | 3300007141 | Bacteria | 107934 |
| 83 | Ga0103267_1048542 | 3300007190 | Bacteria | 1392 |
| 84 | Ga0160442_100306 | 3300012806 | Bacteria | 26599 |
| 85 | Ga0160448_105089 | 3300012854 | Unclassified | 3518 |
| 86 | Ga0316159_11047 | 3300030930 | Bacteria | 4742 |
| 87 | Ga0466693_409881 | 3300042592 | Bacteria | 6813 |
| 88 | Ga0466707_094643 | 3300042601 | Bacteria | 1509 |
| 89 | Ga0466730_005340 | 3300042625 | Bacteria | 3675 |
| 90 | Ga0466730_044645 | 3300042625 | Bacteria | 1865 |
| 91 | Ga0466724_04203 | 3300042649 | Bacteria | 53476 |
| 92 | Ga0466724_49261 | 3300042649 | Bacteria | 63532 |
| 93 | DPO_contig00075 | 2032320009 | Unclassified | 12849 |
| 94 | SPBB_contig11600 | 2044078006 | Unclassified | 19837 |
| 95 | SPBB_contig11636 | 2044078006 | Bacteria | 9105 |
| 96 | Meta3P_1003733 | 3300002464 | Unclassified | 4152 |
| 97 | Ga0103265_1004659 | 3300007068 | Bacteria | 1937 |
| 98 | Ga0103261_1000173 | 3300007083 | Bacteria | 11433 |
| 99 | Ga0103261_1004875 | 3300007083 | Bacteria | 2001 |
| 100 | Ga0102737_1001403 | 3300007142 | Bacteria | 6748 |
| 101 | Ga0562375_0033 | 3300056856 | Bacteria | 624816 |
| 102 | Ga0160452_100043 | 3300012834 | Unclassified | 183151 |
| 103 | Ga0160433_120519 | 3300012846 | Unclassified | 782 |
| 104 | Ga0466701_049869 | 3300042598 | Bacteria | 141978 |
| 105 | Ga0466709_253460 | 3300042648 | Bacteria | 11780 |
| 106 | Ga0466724_05663 | 3300042649 | Unclassified | 7001 |
| 107 | Ga0466724_63399 | 3300042649 | Unclassified | 1136 |
| 108 | DPOL_contig11880 | 2035918003 | Bacteria | 33256 |
| 109 | DPOL_contig13675 | 2035918003 | Unclassified | 13992 |
| 110 | SWWA_contig24484__length_2280___numreads_39 | 2100351016 | Unclassified | 2280 |
| 111 | JGI24696J40584_12948057 | 3300002834 | Bacteria | 1983 |
| 112 | Ga0103263_105763 | 3300007042 | Unclassified | 1392 |
| 113 | Ga0103266_1000030 | 3300007067 | Bacteria | 65303 |
| 114 | Ga0102734_1001103 | 3300007129 | Bacteria | 6860 |
| 115 | Ga0104019_1194898 | 3300007150 | Unclassified | 1277 |
| 116 | Ga0105005_1276846 | 3300007505 | Unclassified | 2844 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00440 | GO:0003677 | DNA binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.