Protein Family IF03913

Metagenome Isolate
343 Members
264 Samples
116 Scaffolds
198.81 Avg Length

🧬 Representative Sequence

ID
3300012846|Ga0160433_100200|Ga0160433_10020030
Length
224 aa
Sequence
MQQMPKVGMQPIRRQQLIEATLLAVDQVGLGDASIALIARLAGVSNGIISHYFQDKNGLIAATMRYIMSMLNEGVVARRQALSDDSPRAHLKVIIEGNFDASQVNGPAMKTWLAFWASSMHQPSLHRLQRINDHRLYSNLCCQFRRVLPIAEARTAARGLAALIDGLWLRGALSGDAFDTEQAIRIAYEYMELQLAKQRPDTELQASEPPRSAIVRQTGARRG*

📊 Sample Types

Isolate 66.2%
Metagenome 33.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Coreidae 27.8%
Unclassified 9.0%
Drosophilidae 8.2%
Anthocoridae 7.8%
Formicidae 7.8%
Curculionidae 7.1%
Muscidae 5.1%
Culicidae 4.7%
Elmidae 3.9%
Calliphoridae 3.5%
Termitidae 2.4%
Apidae 2.0%
Tenebrionidae 2.0%
Tephritidae 1.2%
Armadillidiidae 0.8%
Pentatomidae 0.8%
Sarcophagidae 0.8%
Berytidae 0.8%
Siricidae 0.4%
Crambidae 0.4%
Pteromalidae 0.4%
Thripidae 0.4%
Anthomyiidae 0.4%
Pediculidae 0.4%
Cerambycidae 0.4%
Carabidae 0.4%
Largidae 0.4%
Alydidae 0.4%
Kalotermitidae 0.4%

🌳 Taxonomy

Archaea 0
Bacteria 304
Eukaryota 0
Viruses 0
Unclassified 39

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864739902 Pseudomonas viridiflavia S00001 Isolate Elmidae
2 2864853652 Pseudomonas rhodesiae S00114 Isolate Elmidae
3 2874434233 Serratia marcescens ADJS-2C_Red Isolate Unclassified
4 2961232173 Serratia sp. OLLOLW30 Isolate Anthocoridae
5 2970791725 Serratia sp. OLBL1 Isolate Anthocoridae
6 2977691992 Cronobacter malonaticus MOD1-Md27g Isolate Muscidae
7 2977745872 Cronobacter sakazakii MOD1-Md1g Isolate Muscidae
8 2996467878 Serratia sp. OLFL2 Isolate Anthocoridae
9 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
10 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
11 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
12 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
13 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
14 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
15 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
16 2718217944 Serratia marcescens AS1 Isolate Culicidae
17 2765235945 Kosakonia cowanii Esp_Z Isolate Culicidae
18 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
19 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
20 8025716094 Caballeronia zhejiangensis LZ028 Isolate Coreidae
21 8100176769 Kosakonia sp. S57 Isolate Curculionidae
22 8101960468 Caballeronia sp. AAUFL_F2_KS46 Isolate Coreidae
23 8101988189 Caballeronia sp. ATUFL_F1_KS4A Isolate Coreidae
24 8102014801 Caballeronia sp. ATUFL_M2_KS44 Isolate Coreidae
25 8102060671 Caballeronia sp. GAFFF2 Isolate Coreidae
26 8102152052 Caballeronia sp. LZ001 Isolate Coreidae
27 8102208438 Caballeronia sp. LZ032 Isolate Coreidae
28 8102251710 Caballeronia sp. LZ065 Isolate Coreidae
29 8102279326 Caballeronia sp. NCTM1 Isolate Coreidae
30 2837516909 Rahnella bruchi DSM 27398 Isolate Unclassified
31 2841260384 Providencia alcalifaciens Dmel2 Isolate Drosophilidae
32 2878947168 Serratia marcescens ADJS-2D_White Isolate Unclassified
33 2885043073 Erwinia sp. OLSSP12 Isolate Anthocoridae
34 2896187957 Providencia stuartii Crippen Isolate Calliphoridae
35 2937735258 Serratia marcescens KZ11 Isolate Apidae
36 2961247850 Serratia sp. OLAL2 Isolate Anthocoridae
37 2970335472 Cronobacter muytjensii MOD1-Md1s Isolate Muscidae
38 2977727922 Cronobacter sakazakii MOD1-Md33s Isolate Muscidae
39 2997878596 Pseudomonas bohemica IA9 Isolate Unclassified
40 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
41 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
42 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
43 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
44 2100351016 Sirex noctilio microbial communities from Pennsylvania, USA - adult community Metagenome Siricidae
45 2551306531 Enterobacter hormaechei YT2 Isolate Tenebrionidae
46 2731957969 Proteus mirabilis Wood Isolate Calliphoridae
47 8004307473 Serratia sp. OLIL2 Isolate Anthocoridae
48 8004571736 Serratia sp. OLDL1 Isolate Anthocoridae
49 8021535516 Klebsiella sp. Kd70 TUC-EEAOC Isolate Crambidae
50 8023757577 Caballeronia peredens LP006 Isolate Coreidae
51 8023764196 Caballeronia peredens LZ001 Isolate Coreidae
52 8025678175 Caballeronia hypogeia LZ043 Isolate Coreidae
53 8025747911 Caballeronia peredens LZ003 Isolate Coreidae
54 8035321120 Pseudomonas prosekii A2-NA12 Isolate Curculionidae
55 8069755105 Caballeronia sp. LZ003 Isolate Coreidae
56 8100181737 Kosakonia sp. S58 Isolate Curculionidae
57 8101951471 Caballeronia sp. AAUFL_F1_KS45 Isolate Coreidae
58 8101974301 Caballeronia sp. ASUFL_F2_KS49 Isolate Coreidae
59 8101981714 Caballeronia sp. ATUFL_F1_KS39 Isolate Coreidae
60 8102020860 Caballeronia sp. AZ10_KS36 Isolate Coreidae
61 8102026984 Caballeronia sp. AZ1_KS37 Isolate Coreidae
62 8102067727 Caballeronia sp. GAFFF3 Isolate Coreidae
63 2846386538 Rahnella sp. AN3-3W3 Isolate Pentatomidae
64 2864751016 Pseudomonas oryzihabitans S00005 Isolate Elmidae
65 2864840607 Acinetobacter johnsonii S00071 Isolate Elmidae
66 2876358570 Cronobacter sakazakii MOD1-Ls15g Isolate Calliphoridae
67 2937387794 Cronobacter turicensis MOD1-Sh41g Isolate Sarcophagidae
68 2971189173 Yersinia pestis A-1249 Isolate Unclassified
69 2972038244 Pseudomonas sp. DS1 Isolate Formicidae
70 2990166910 Pseudomonas typographi CA3A Isolate Curculionidae
71 3007478678 Pseudomonas sp. S37 Isolate Curculionidae
72 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
73 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
74 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
75 3300007767 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut Metagenome Drosophilidae
76 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
77 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
78 3300026175 Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 Metagenome Formicidae
79 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
80 2597489902 Providencia rettgeri Dmel1 Isolate Drosophilidae
81 2687453756 Pseudomonadales bacterium Cag32 Isolate Unclassified
82 637000219 Pseudomonas entomophila L48 Isolate Unclassified
83 8021546568 Klebsiella sp. Kps Isolate Tephritidae
84 8025658853 Caballeronia temeraria LZ065 Isolate Coreidae
85 8025708040 Caballeronia jiangsuensis LZ029 Isolate Coreidae
86 8035326735 Pseudomonas prosekii A2-NA13 Isolate Curculionidae
87 8065462725 Tatumella sp. JGM100 Isolate Drosophilidae
88 8065466226 Tatumella sp. JGM130 Isolate Drosophilidae
89 8065469765 Tatumella sp. JGM16 Isolate Drosophilidae
90 8069770227 Caballeronia sp. LZ019 Isolate Coreidae
91 8071322446 Escherichia coli PN122 Isolate Calliphoridae
92 8100171289 Kosakonia sp. S42 Isolate Curculionidae
93 8101680043 Providencia sp. JGM178 Isolate Drosophilidae
94 8101994502 Caballeronia sp. ATUFL_F2_KS42 Isolate Coreidae
95 8102124461 Caballeronia sp. INML3B Isolate Coreidae
96 8102193924 Caballeronia sp. LZ029 Isolate Coreidae
97 8102312426 Caballeronia sp. AAUFL_F1_KS47 Isolate Coreidae
98 8103002986 Erwinia sp. S38 Isolate Curculionidae
99 8103008710 Erwinia sp. S43 Isolate Curculionidae
100 2822856742 Enterobacter cancerogenus CR-Eb1 Isolate Unclassified
101 2850131454 Providencia rettgeri NVIT03 Isolate Pteromalidae
102 2874880541 Enterobacter hormaechei E3442 Isolate Unclassified
103 2964846109 Cronobacter sakazakii MOD1-Md5g Isolate Muscidae
104 2964859436 Cronobacter sakazakii MOD1-Md40g Isolate Muscidae
105 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
106 2978161719 Serratia marcescens KZ2 Isolate Apidae
107 3004364956 Cronobacter sakazakii MOD1-Md5s Isolate Muscidae
108 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
109 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
110 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae
111 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
112 2547132185 Enterobacter cancerogenus YZ1 Isolate Tenebrionidae
113 2619619082 Pantoea agglomerans SL1_M5 Isolate Unclassified
114 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
115 8018312681 Enterobacter sp. OLF Isolate Tephritidae
116 8021540981 Klebsiella sp. Kpp Isolate Tephritidae
117 8024014383 Caballeronia sp. SL2Y3 Isolate Berytidae
118 8025740903 Caballeronia zhejiangensis LZ008 Isolate Coreidae
119 8069748016 Caballeronia sp. LP003 Isolate Coreidae
120 8102033761 Caballeronia sp. AZ7_KS35 Isolate Coreidae
121 8102094248 Caballeronia sp. GaOx3 Isolate Coreidae
122 8102109360 Caballeronia sp. INML2 Isolate Coreidae
123 8102145433 Caballeronia sp. LP006 Isolate Coreidae
124 8102186987 Caballeronia sp. LZ028 Isolate Coreidae
125 8102223607 Caballeronia sp. LZ034LL Isolate Coreidae
126 8102286609 Caballeronia sp. NCTM5 Isolate Coreidae
127 2864843793 Acinetobacter johnsonii S00075 Isolate Elmidae
128 2864903489 Pseudomonas aeuginosa S00161 Isolate Elmidae
129 2871760914 Pantoea ananatis PANS 01-2 Isolate Thripidae
130 2921816052 Cronobacter sakazakii MOD1-Anth48g Isolate Anthomyiidae
131 2922113941 Serratia sp. OLEL1 Isolate Anthocoridae
132 2937427229 Cronobacter malonaticus MOD1-Md99g Isolate Muscidae
133 2937751072 Serratia sp. OLMTLW26 Isolate Anthocoridae
134 2958255616 Serratia marcescens TM Isolate
135 2965197371 Serratia sp. OLCL1 Isolate Anthocoridae
136 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
137 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
138 3001459110 Tatumella sp. JGM118 Isolate Drosophilidae
139 3300007130 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut Metagenome Drosophilidae
140 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
141 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
142 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
143 2032320009 Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine Metagenome Curculionidae
144 2507262057 Enterobacteriaceae bacterium FGI 57 Isolate Unclassified
145 2551306516 Enterobacter hormaechei YT3 Isolate Tenebrionidae
146 2603880173 Pseudomonas SP. Isolate Unclassified
147 2687453755 Pseudomonadales bacterium Cag27 Isolate Unclassified
148 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
149 641522603 Acinetobacter baumannii SDF Isolate Pediculidae
150 8025650824 Caballeronia hypogeia LZ032 Isolate Coreidae
151 8025671076 Caballeronia cordobensis LZ034LL Isolate Coreidae
152 8025735396 Caballeronia zhejiangensis LZ016 Isolate Coreidae
153 8071333649 Escherichia coli PN108 Isolate Calliphoridae
154 8071338694 Escherichia coli PN87 Isolate Calliphoridae
155 8102047609 Caballeronia sp. GACF5 Isolate Coreidae
156 8102074813 Caballeronia sp. GAWG1-1 Isolate Coreidae
157 8102081745 Caballeronia sp. GAWG1-5s-s Isolate Coreidae
158 8102117041 Caballeronia sp. INML3 Isolate Coreidae
159 8102131453 Caballeronia sp. INML5 Isolate Coreidae
160 8102138357 Caballeronia sp. INSB1 Isolate Coreidae
161 8102216467 Caballeronia sp. LZ033 Isolate Coreidae
162 8102230706 Caballeronia sp. LZ035 Isolate Coreidae
163 8102239244 Caballeronia sp. LZ043 Isolate Coreidae
164 8102982778 Erwinia sp. S63 Isolate Curculionidae
165 2847708326 Serratia liquefaciens P2ACOL2 Isolate Cerambycidae
166 2856068565 Cronobacter sakazakii MOD1-Md35s Isolate Muscidae
167 2864745180 Pseudomonas rhodesiae S00002 Isolate Elmidae
168 2864804954 Acinetobacter johnsonii S00050 Isolate Elmidae
169 2864847319 Pseudomonas alcaligenes S00099 Isolate Elmidae
170 2874504452 Serratia marcescens ADJS-2C_Purple Isolate Unclassified
171 2885058212 Erwinia sp. OLTSP20 Isolate Anthocoridae
172 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
173 2967924226 Cronobacter malonaticus MOD1-Md25g Isolate Muscidae
174 2970322301 Cronobacter sakazakii MOD1-Md33g Isolate Muscidae
175 2996406003 Serratia sp. OLJL1 Isolate Anthocoridae
176 3001462594 Tatumella sp. JGM91 Isolate Drosophilidae
177 3006190525 Acinetobacter sp. S54 Isolate Curculionidae
178 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
179 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
180 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
181 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
182 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
183 2044078006 Dendroctonus frontalis bacterial communities from Mississippi, USA Metagenome Curculionidae
184 2588253732 Klebsiella pneumoniae pneumoniae KP5-1 Isolate Pentatomidae
185 8004118532 Citrobacter amalonaticus ku-bf3 Isolate Carabidae
186 8023724303 Caballeronia zhejiangensis LP003 Isolate Coreidae
187 8024001094 Caballeronia sp. TF1N1 Isolate Berytidae
188 8025694439 Caballeronia cordobensis LZ033 Isolate Coreidae
189 8052469819 Pseudomonas putida DZ-F23 Isolate
190 8071343737 Escherichia coli PN119 Isolate Calliphoridae
191 8074288691 Tatumella sp. JGM82 Isolate Drosophilidae
192 8101683685 Providencia sp. JGM181 Isolate Drosophilidae
193 8101967387 Caballeronia sp. AAUFL_F3_KS11A Isolate Coreidae
194 8102007614 Caballeronia sp. ATUFL_M1_KS5A Isolate Coreidae
195 8102041249 Caballeronia sp. GACF4 Isolate Coreidae
196 8102087471 Caballeronia sp. GAWG2-1 Isolate Coreidae
197 8102264549 Caballeronia sp. NCF2 Isolate Coreidae
198 2835335304 Rahnella sp. Larv3_ips Isolate Curculionidae
199 2876334352 Cronobacter sakazakii MOD1-Md6g Isolate Muscidae
200 2885050628 Erwinia sp. OLMTSP26 Isolate Anthocoridae
201 2885061987 Erwinia sp. OLFS4 Isolate Anthocoridae
202 2885065815 Erwinia sp. OAMSP11 Isolate Anthocoridae
203 2961206375 Serratia sp. OMLW3 Isolate Anthocoridae
204 3003878002 Paraburkholderia sp. PGU19 Isolate Largidae
205 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
206 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
207 3300005318 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut Metagenome Drosophilidae
208 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
209 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
210 3300007136 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 4 gut Metagenome Drosophilidae
211 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
212 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
213 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
214 2519899623 Enterobacter sp. Ag1 Isolate Culicidae
215 2597489944 Caballeronia insecticola RPE64 Isolate Alydidae
216 2703719239 Serratia marcescens ano1 Isolate Unclassified
217 2778261153 Escherichia coli MOD1-EC286 Isolate Unclassified
218 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
219 8004285568 Serratia sp. OLHL2 Isolate Anthocoridae
220 8004541719 Serratia marcescens KZ19 Isolate Apidae
221 8004582426 Serratia sp. OSPLW9 Isolate Anthocoridae
222 8024044713 Caballeronia sp. Sq4a Isolate Coreidae
223 8035422605 Pseudomonas monteilii CY06 Isolate
224 8069763219 Caballeronia sp. LZ008 Isolate Coreidae
225 8102001125 Caballeronia sp. ATUFL_F2_KS9A Isolate Coreidae
226 8102169119 Caballeronia sp. LZ016 Isolate Coreidae
227 8102181083 Caballeronia sp. LZ025 Isolate Coreidae
228 8102271933 Caballeronia sp. NCF4 Isolate Coreidae
229 2864863795 Acinetobacter johnsonii S00116 Isolate Elmidae
230 2871771314 Pantoea sp. Ae16 Isolate Culicidae
231 2885046828 Erwinia sp. OLCASP19 Isolate Anthocoridae
232 2885054481 Erwinia sp. OLMDSP33 Isolate Anthocoridae
233 2921842437 Cronobacter sakazakii MOD1-Lc10s Isolate Calliphoridae
234 2957730672 Cronobacter sakazakii MOD1-Md70g Isolate Muscidae
235 2967915117 Cronobacter sakazakii MOD1-Lc10g Isolate Calliphoridae
236 2979682021 Cronobacter turicensis MOD1-Sh41s Isolate Sarcophagidae
237 3006156446 Acinetobacter baretiae B10A Isolate Apidae
238 3007473699 Pseudomonas sp. S30 Isolate Curculionidae
239 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
240 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
241 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
242 3300007149 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut Metagenome Drosophilidae
243 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
244 2519899622 Pseudomonas sp. Ag1 Isolate Culicidae
245 2529292851 Providencia burhodogranariea DSM 19968 Isolate Drosophilidae
246 2651870110 Izhakiella capsodis N6PO6 Isolate Unclassified
247 2687453754 Pseudomonadales bacterium Cag26 Isolate Unclassified
248 2703719240 Serratia marcescens ano2 Isolate Unclassified
249 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
250 648276708 Pantoea sp. aB Isolate Unclassified
251 8011329375 Pseudomonas sp. S31 Isolate Curculionidae
252 8023747282 Caballeronia zhejiangensis LZ019 Isolate Coreidae
253 8024025509 Caballeronia grimmiae Lep1A1 Isolate Coreidae
254 8024037630 Caballeronia zhejiangensis A33_M4_a Isolate Coreidae
255 8025685901 Caballeronia fortuita LZ035 Isolate Coreidae
256 8025723035 Caballeronia grimmiae LZ025 Isolate Coreidae
257 8025756023 Caballeronia peredens LZ002 Isolate Coreidae
258 8073124432 Escherichia coli MOD1-EC294 Isolate Unclassified
259 8074292191 Tatumella sp. JGM94 Isolate Drosophilidae
260 8078130113 Caballeronia sp. INDeC2 Isolate Coreidae
261 8101676404 Providencia sp. JGM172 Isolate Drosophilidae
262 8102054868 Caballeronia sp. GAFFF1 Isolate Coreidae
263 8102102351 Caballeronia sp. INML1 Isolate Coreidae
264 8102161003 Caballeronia sp. LZ002 Isolate Coreidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0160447_101371 3300012849 Unclassified 9557
2 Ga0160436_1016882 3300012861 Unclassified 1450
3 Ga0466713_014081 3300042602 Bacteria 234884
4 Ga0466730_000896 3300042625 Bacteria 1356
5 Ga0466730_082332 3300042625 Bacteria 6475
6 Ga0466725_119246 3300042654 Bacteria 4058
7 DPOL_contig06450 2035918003 Bacteria 1180
8 FGTW_contig33001 2065487013 Unclassified 1922
9 HBC_ctgsDRAFT_1009175 3300000333 Bacteria 2346
10 CVPL005W_1009246 3300002934 Unclassified 1656
11 Ga0103266_1000124 3300007067 Bacteria 26330
12 Ga0104041_1002451 3300007106 Unclassified 6457
13 Ga0103268_1000468 3300007192 Bacteria 12452
14 Ga0103268_1002880 3300007192 Bacteria 3712
15 Ga0160465_100363 3300012803 Bacteria 25628
16 Ga0160453_100577 3300012814 Unclassified 25252
17 Ga0160467_102241 3300012829 Bacteria 4637
18 Ga0160433_100200 3300012846 Bacteria 48402
19 Ga0160435_1000434 3300012857 Bacteria 14325
20 Ga0160436_1004913 3300012861 Bacteria 3156
21 Ga0466701_063769 3300042598 Bacteria 151198
22 SWWA_contig32505__length_1273___numreads_25 2100351016 Bacteria 1273
23 CVPL010L_1000283 3300002932 Unclassified 13180
24 Ga0103260_1000351 3300007139 Bacteria 9217
25 Ga0103260_1001478 3300007139 Unclassified 4200
26 Ga0102740_1002044 3300007140 Unclassified 7192
27 Ga0103264_1000164 3300007188 Bacteria 38481
28 Ga0103264_1000384 3300007188 Bacteria 24020
29 Ga0103267_1028257 3300007190 Bacteria 1870
30 Ga0105553_1018467 3300007767 Unclassified 5023
31 Ga0160467_101220 3300012829 Unclassified 11649
32 Ga0466701_092881 3300042598 Bacteria 1172
33 Ga0466713_064612 3300042602 Bacteria 2667
34 Ga0466730_038303 3300042625 Bacteria 6932
35 Ga0466730_081934 3300042625 Bacteria 1783
36 Ga0466724_64720 3300042649 Unclassified 9652
37 CVPL010W_10000003 3300002931 Bacteria 118695
38 CVPL010W_10000815 3300002931 Bacteria 35180
39 CVPL005W_1000911 3300002934 Bacteria 9494
40 Ga0104042_1123405 3300007130 Bacteria 1439
41 Ga0104044_1020226 3300007136 Unclassified 2273
42 Ga0102740_1000001 3300007140 Bacteria 144366
43 Ga0102737_1017408 3300007142 Bacteria 1133
44 Ga0104040_1149057 3300007149 Bacteria 1285
45 Ga0160459_102089 3300012831 Unclassified 3482
46 Ga0466701_028580 3300042598 Bacteria 18128
47 Ga0466730_038260 3300042625 Unclassified 3441
48 Ga0466730_038563 3300042625 Unclassified 97380
49 Ga0466724_31803 3300042649 Bacteria 19762
50 Ga0466724_36510 3300042649 Bacteria 2804
51 Ga0466725_043776 3300042654 Bacteria 6765
52 FGTW_contig26805 2065487013 Unclassified 30361
53 FGTW_contig33186 2065487013 Unclassified 1762
54 SWWA_contig31643__length_39767___numreads_2414 2100351016 Bacteria 39767
55 Meta3P_1001557 3300002464 Unclassified 3849
56 Ga0063521_1000006 3300003973 Bacteria 230945
57 Ga0102736_1000770 3300007052 Bacteria 6055
58 Ga0103265_1000299 3300007068 Bacteria 8241
59 Ga0102739_1000514 3300007095 Unclassified 7755
60 Ga0105005_1042976 3300007505 Unclassified 11724
61 Ga0160460_100928 3300012845 Unclassified 12477
62 Ga0265387_1000656 3300024582 Bacteria 5344
63 Ga0466701_021959 3300042598 Bacteria 104761
64 Ga0466701_033267 3300042598 Bacteria 1669
65 FGTW_contig27111 2065487013 Unclassified 1371
66 SWWA_contig24645__length_2599___numreads_38 2100351016 Unclassified 2599
67 CVPL010W_10004945 3300002931 Bacteria 14542
68 Ga0074188_1000412 3300005318 Bacteria 30301
69 Ga0103263_106911 3300007042 Bacteria 1237
70 Ga0562377_0001 3300056842 Bacteria 5082480
71 Ga0265387_1000032 3300024582 Bacteria 53128
72 Ga0255572_1000003 3300026175 Bacteria 262489
73 Ga0466713_148277 3300042602 Bacteria 181035
74 Ga0466730_019320 3300042625 Bacteria 147177
75 Ga0466730_054947 3300042625 Bacteria 59975
76 Ga0466724_17617 3300042649 Unclassified 2803
77 DPOL_contig02480 2035918003 Bacteria 30675
78 Meta3P_1000328 3300002464 Bacteria 80534
79 Meta3P_1001554 3300002464 Bacteria 12775
80 CVPL010W_10009178 3300002931 Bacteria 9071
81 CVPL010L_1002714 3300002932 Unclassified 3426
82 Ga0102738_1000010 3300007141 Bacteria 107934
83 Ga0103267_1048542 3300007190 Bacteria 1392
84 Ga0160442_100306 3300012806 Bacteria 26599
85 Ga0160448_105089 3300012854 Unclassified 3518
86 Ga0316159_11047 3300030930 Bacteria 4742
87 Ga0466693_409881 3300042592 Bacteria 6813
88 Ga0466707_094643 3300042601 Bacteria 1509
89 Ga0466730_005340 3300042625 Bacteria 3675
90 Ga0466730_044645 3300042625 Bacteria 1865
91 Ga0466724_04203 3300042649 Bacteria 53476
92 Ga0466724_49261 3300042649 Bacteria 63532
93 DPO_contig00075 2032320009 Unclassified 12849
94 SPBB_contig11600 2044078006 Unclassified 19837
95 SPBB_contig11636 2044078006 Bacteria 9105
96 Meta3P_1003733 3300002464 Unclassified 4152
97 Ga0103265_1004659 3300007068 Bacteria 1937
98 Ga0103261_1000173 3300007083 Bacteria 11433
99 Ga0103261_1004875 3300007083 Bacteria 2001
100 Ga0102737_1001403 3300007142 Bacteria 6748
101 Ga0562375_0033 3300056856 Bacteria 624816
102 Ga0160452_100043 3300012834 Unclassified 183151
103 Ga0160433_120519 3300012846 Unclassified 782
104 Ga0466701_049869 3300042598 Bacteria 141978
105 Ga0466709_253460 3300042648 Bacteria 11780
106 Ga0466724_05663 3300042649 Unclassified 7001
107 Ga0466724_63399 3300042649 Unclassified 1136
108 DPOL_contig11880 2035918003 Bacteria 33256
109 DPOL_contig13675 2035918003 Unclassified 13992
110 SWWA_contig24484__length_2280___numreads_39 2100351016 Unclassified 2280
111 JGI24696J40584_12948057 3300002834 Bacteria 1983
112 Ga0103263_105763 3300007042 Unclassified 1392
113 Ga0103266_1000030 3300007067 Bacteria 65303
114 Ga0102734_1001103 3300007129 Bacteria 6860
115 Ga0104019_1194898 3300007150 Unclassified 1277
116 Ga0105005_1276846 3300007505 Unclassified 2844

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13977 TetR_C_6 BetI-type transcriptional repressor, C-terminal 87 195 0.97
PF00440 TetR_N Bacterial regulatory proteins, tetR family 18 62 0.9

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00440 GO:0003677 DNA binding MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.