Protein Family IF03910
Metagenome
Isolate
301
Members
90
Samples
268
Scaffolds
201.11
Avg Length
Representative Sequence
- ID
- 3300012846|Ga0160433_100030|Ga0160433_100030101
- Length
- 205 aa
- Sequence
- VHLGFVYLRIMFTGIIETLGEVVDLQKDKGNLQIKISSSFSSELKVDQSVAHNGVCLTVVNVQDDTHTVTAVEETLTKTNLARLQPGSLVNLERCMQMNGRLDGHIVQGHVDQVATCTDVRGLEGSWVYSFSYDPELGNVTVEKGSICVNGVSLTVVNSDTASFSVAIIPYTHEHTNFNALQAGDQVNLEFDIIGKYVARLLKV*
Sample Types
Isolate
11.0%
Metagenome
89.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
25.8%
Blattidae
21.3%
Kalotermitidae
15.7%
Unclassified
13.5%
Rhinotermitidae
5.6%
Passalidae
4.5%
Termopsidae
4.5%
Armadillidiidae
3.4%
Hydrophilidae
2.2%
Hodotermitidae
1.1%
Daphniidae
1.1%
Tenebrionidae
1.1%
Taxonomy
Archaea
0
Bacteria
285
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 2 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 3 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 4 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 5 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 6 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 7 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 8 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 9 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 10 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 11 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 12 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 13 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 14 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 15 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 16 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 17 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 18 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 19 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 20 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 21 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 22 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 23 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 24 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 25 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 26 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 27 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 28 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 29 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 30 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 31 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 32 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 33 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 34 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 35 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 36 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 37 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 38 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 39 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 40 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 41 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 42 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 43 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 44 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 45 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 46 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 47 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 48 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 49 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 50 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 51 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 52 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 53 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 54 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 55 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 56 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 57 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 58 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 59 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 60 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 61 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 62 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 63 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 64 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 65 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 66 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 67 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 68 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 69 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 70 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 71 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 72 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 73 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 74 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 75 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 76 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 77 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 78 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 79 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 80 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 81 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 82 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 83 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 84 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 85 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 86 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 87 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 88 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 89 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 90 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_084665 | 3300042612 | Bacteria | 3609 |
| 2 | Ga0466705_209917 | 3300042612 | Unclassified | 2346 |
| 3 | Ga0466705_372016 | 3300042612 | Bacteria | 17065 |
| 4 | Ga0466732_104713 | 3300042656 | Bacteria | 2489 |
| 5 | Ga0466733_017489 | 3300042659 | Bacteria | 155887 |
| 6 | Ga0466733_147625 | 3300042659 | Bacteria | 13929 |
| 7 | Ga0466733_183658 | 3300042659 | Bacteria | 5767 |
| 8 | Ga0123355_10000613 | 3300009826 | Bacteria | 48149 |
| 9 | Ga0160469_100034 | 3300012824 | Bacteria | 258609 |
| 10 | Ga0160467_100051 | 3300012829 | Bacteria | 176753 |
| 11 | Ga0160433_100030 | 3300012846 | Bacteria | 173311 |
| 12 | Ga0466690_043047 | 3300042590 | Bacteria | 27085 |
| 13 | Ga0466690_155934 | 3300042590 | Bacteria | 2225 |
| 14 | Ga0466706_117702 | 3300042599 | Bacteria | 16236 |
| 15 | Ga0466707_184910 | 3300042601 | Bacteria | 13050 |
| 16 | Ga0466707_198291 | 3300042601 | Bacteria | 10236 |
| 17 | Ga0466707_203594 | 3300042601 | Bacteria | 6384 |
| 18 | Ga0466707_389269 | 3300042601 | Bacteria | 2529 |
| 19 | 2227075236 | 2225789003 | Bacteria | 10777 |
| 20 | IMNBGM34_c011848 | 3300000036 | Bacteria | 1095 |
| 21 | IMNBL1DRAFT_c0004653 | 3300000062 | Bacteria | 8143 |
| 22 | IMNBL1DRAFT_c0027330 | 3300000062 | Bacteria | 2147 |
| 23 | JGI24702J35022_10052737 | 3300002462 | Bacteria | 2169 |
| 24 | JGI24702J35022_10115694 | 3300002462 | Bacteria | 1478 |
| 25 | JGI24705J35276_12234820 | 3300002504 | Bacteria | 5883 |
| 26 | Ga0068305_10011093 | 3300005083 | Bacteria | 20208 |
| 27 | Ga0466729_276375 | 3300042621 | Bacteria | 7159 |
| 28 | Ga0466735_068864 | 3300042624 | Bacteria | 13806 |
| 29 | Ga0466735_106185 | 3300042624 | Bacteria | 4824 |
| 30 | Ga0466703_421640 | 3300042636 | Bacteria | 7349 |
| 31 | Ga0466704_093062 | 3300042643 | Bacteria | 10894 |
| 32 | Ga0466704_619871 | 3300042643 | Bacteria | 22946 |
| 33 | Ga0466724_12329 | 3300042649 | Bacteria | 4241 |
| 34 | Ga0466708_160923 | 3300042652 | Bacteria | 24813 |
| 35 | Ga0466715_045705 | 3300042616 | Bacteria | 11443 |
| 36 | Ga0466715_309862 | 3300042616 | Bacteria | 99913 |
| 37 | Ga0466723_023862 | 3300042618 | Bacteria | 63714 |
| 38 | Ga0466728_367487 | 3300042620 | Bacteria | 3733 |
| 39 | Ga0466728_448588 | 3300042620 | Bacteria | 26584 |
| 40 | Ga0466705_031434 | 3300042612 | Bacteria | 39201 |
| 41 | Ga0466733_025154 | 3300042659 | Bacteria | 1156 |
| 42 | Ga0466733_043260 | 3300042659 | Bacteria | 38032 |
| 43 | Ga0123357_10008051 | 3300009784 | Unclassified | 13121 |
| 44 | Ga0123357_10080741 | 3300009784 | Bacteria | 4277 |
| 45 | Ga0123357_10090567 | 3300009784 | Unclassified | 3989 |
| 46 | Ga0123356_10071925 | 3300010049 | Bacteria | 3248 |
| 47 | Ga0123353_10081414 | 3300010167 | Bacteria | 5206 |
| 48 | Ga0123353_10263505 | 3300010167 | Bacteria | 2660 |
| 49 | Ga0123353_10617324 | 3300010167 | Bacteria | 1545 |
| 50 | Ga0123354_10003821 | 3300010882 | Bacteria | 21020 |
| 51 | Ga0123354_10029236 | 3300010882 | Bacteria | 8673 |
| 52 | Ga0466656_363341 | 3300042550 | Bacteria | 1380 |
| 53 | Ga0466690_299445 | 3300042590 | Bacteria | 1322 |
| 54 | Ga0466690_388851 | 3300042590 | Bacteria | 15302 |
| 55 | Ga0466693_169302 | 3300042592 | Bacteria | 1550 |
| 56 | Ga0466696_104767 | 3300042596 | Bacteria | 2396 |
| 57 | Ga0466696_366829 | 3300042596 | Bacteria | 6857 |
| 58 | Ga0466706_220909 | 3300042599 | Bacteria | 6749 |
| 59 | Ga0466707_083675 | 3300042601 | Bacteria | 1435 |
| 60 | Ga0466716_066194 | 3300042605 | Bacteria | 20176 |
| 61 | Ga0466719_048934 | 3300042606 | Bacteria | 8668 |
| 62 | Ga0466722_184923 | 3300042609 | Bacteria | 7645 |
| 63 | JGI24699J35502_11132802 | 3300002509 | Bacteria | 7658 |
| 64 | Ga0068305_10007042 | 3300005083 | Bacteria | 2046 |
| 65 | Ga0123357_10000223 | 3300009784 | Bacteria | 53671 |
| 66 | Ga0466735_081735 | 3300042624 | Bacteria | 1992 |
| 67 | Ga0466735_090589 | 3300042624 | Bacteria | 2010 |
| 68 | Ga0466703_206442 | 3300042636 | Bacteria | 11935 |
| 69 | Ga0466703_431083 | 3300042636 | Bacteria | 9810 |
| 70 | Ga0466704_183641 | 3300042643 | Unclassified | 1702 |
| 71 | Ga0466711_263003 | 3300042615 | Unclassified | 5221 |
| 72 | Ga0466711_332880 | 3300042615 | Bacteria | 2185 |
| 73 | Ga0466711_338062 | 3300042615 | Bacteria | 14964 |
| 74 | Ga0466723_204456 | 3300042618 | Bacteria | 10737 |
| 75 | Ga0466728_051744 | 3300042620 | Bacteria | 107334 |
| 76 | Ga0466728_346665 | 3300042620 | Bacteria | 2507 |
| 77 | Ga0466697_265139 | 3300042611 | Bacteria | 1538 |
| 78 | Ga0123357_10042627 | 3300009784 | Bacteria | 6170 |
| 79 | Ga0466656_043457 | 3300042550 | Bacteria | 4331 |
| 80 | Ga0466656_064295 | 3300042550 | Bacteria | 21933 |
| 81 | Ga0466690_275100 | 3300042590 | Bacteria | 4120 |
| 82 | Ga0466692_025105 | 3300042591 | Bacteria | 10490 |
| 83 | Ga0466693_318919 | 3300042592 | Bacteria | 2283 |
| 84 | Ga0466691_045847 | 3300042593 | Bacteria | 49393 |
| 85 | Ga0466691_071708 | 3300042593 | Bacteria | 18929 |
| 86 | Ga0466691_096721 | 3300042593 | Bacteria | 5230 |
| 87 | Ga0466706_109799 | 3300042599 | Bacteria | 205088 |
| 88 | Ga0466700_208515 | 3300042600 | Bacteria | 11675 |
| 89 | Ga0466700_343869 | 3300042600 | Bacteria | 10747 |
| 90 | Ga0466707_056056 | 3300042601 | Bacteria | 4127 |
| 91 | Ga0466707_301453 | 3300042601 | Bacteria | 14839 |
| 92 | Ga0466713_024058 | 3300042602 | Bacteria | 7368 |
| 93 | Ga0466713_031005 | 3300042602 | Bacteria | 38195 |
| 94 | Ga0466716_306068 | 3300042605 | Bacteria | 5416 |
| 95 | Ga0466719_027993 | 3300042606 | Bacteria | 7492 |
| 96 | Ga0466719_101697 | 3300042606 | Bacteria | 6495 |
| 97 | Ga0466722_207195 | 3300042609 | Bacteria | 15872 |
| 98 | Ga0068302_10703961 | 3300005071 | Bacteria | 755 |
| 99 | Ga0068305_10001070 | 3300005083 | Bacteria | 29351 |
| 100 | Ga0068305_10040958 | 3300005083 | Unclassified | 10875 |
| 101 | Ga0068305_10279822 | 3300005083 | Bacteria | 1882 |
| 102 | Ga0466735_029803 | 3300042624 | Bacteria | 3054 |
| 103 | Ga0466709_298460 | 3300042648 | Bacteria | 4465 |
| 104 | Ga0466709_345568 | 3300042648 | Bacteria | 3145 |
| 105 | Ga0466727_014399 | 3300042655 | Bacteria | 11624 |
| 106 | Ga0466711_330525 | 3300042615 | Bacteria | 9097 |
| 107 | Ga0466715_132314 | 3300042616 | Bacteria | 8516 |
| 108 | Ga0466723_171893 | 3300042618 | Bacteria | 8696 |
| 109 | Ga0466723_313763 | 3300042618 | Bacteria | 27327 |
| 110 | Ga0466728_089600 | 3300042620 | Bacteria | 17825 |
| 111 | Ga0466728_153880 | 3300042620 | Bacteria | 9544 |
| 112 | Ga0466729_034177 | 3300042621 | Bacteria | 1376 |
| 113 | Ga0466729_191874 | 3300042621 | Unclassified | 3975 |
| 114 | Ga0123354_10002290 | 3300010882 | Bacteria | 25040 |
| 115 | Ga0123354_10166380 | 3300010882 | Bacteria | 2590 |
| 116 | Ga0466696_047213 | 3300042596 | Bacteria | 1161 |
| 117 | Ga0466696_054357 | 3300042596 | Bacteria | 37826 |
| 118 | Ga0466696_062788 | 3300042596 | Bacteria | 2411 |
| 119 | Ga0466696_445273 | 3300042596 | Bacteria | 1045 |
| 120 | Ga0466706_024532 | 3300042599 | Bacteria | 14197 |
| 121 | Ga0466707_160481 | 3300042601 | Bacteria | 32425 |
| 122 | Ga0466707_298681 | 3300042601 | Bacteria | 31882 |
| 123 | Ga0466719_106251 | 3300042606 | Bacteria | 7638 |
| 124 | Ga0466719_516455 | 3300042606 | Bacteria | 3600 |
| 125 | 2227513251 | 2225789004 | Bacteria | 3506 |
| 126 | IMNBL1DRAFT_c0004089 | 3300000062 | Bacteria | 8920 |
| 127 | IMNBL1DRAFT_c0010489 | 3300000062 | Bacteria | 4426 |
| 128 | IMNBL1DRAFT_c0013015 | 3300000062 | Bacteria | 3763 |
| 129 | IMNBL1DRAFT_c0016827 | 3300000062 | Bacteria | 3110 |
| 130 | JGI24702J35022_10083215 | 3300002462 | Unclassified | 1735 |
| 131 | Ga0123357_10000452 | 3300009784 | Bacteria | 39673 |
| 132 | Ga0466734_108204 | 3300042623 | Bacteria | 3279 |
| 133 | Ga0466735_003871 | 3300042624 | Bacteria | 4439 |
| 134 | Ga0466735_163209 | 3300042624 | Bacteria | 2497 |
| 135 | Ga0466704_090514 | 3300042643 | Bacteria | 2986 |
| 136 | Ga0466708_221268 | 3300042652 | Bacteria | 13982 |
| 137 | Ga0466725_084562 | 3300042654 | Bacteria | 24813 |
| 138 | Ga0466727_110754 | 3300042655 | Bacteria | 5631 |
| 139 | Ga0466727_295467 | 3300042655 | Bacteria | 1094 |
| 140 | Ga0466711_221193 | 3300042615 | Bacteria | 3249 |
| 141 | Ga0466715_077989 | 3300042616 | Unclassified | 24406 |
| 142 | Ga0466723_069125 | 3300042618 | Bacteria | 6419 |
| 143 | Ga0466726_180711 | 3300042619 | Bacteria | 2066 |
| 144 | Ga0466726_482331 | 3300042619 | Bacteria | 2920 |
| 145 | Ga0466728_181334 | 3300042620 | Bacteria | 75129 |
| 146 | Ga0466697_175381 | 3300042611 | Bacteria | 1469 |
| 147 | Ga0123354_10367066 | 3300010882 | Bacteria | 1261 |
| 148 | Ga0466690_017033 | 3300042590 | Bacteria | 5971 |
| 149 | Ga0466690_293895 | 3300042590 | Bacteria | 67504 |
| 150 | Ga0466692_146541 | 3300042591 | Bacteria | 1337 |
| 151 | Ga0466691_018888 | 3300042593 | Bacteria | 30398 |
| 152 | Ga0466691_036539 | 3300042593 | Bacteria | 23739 |
| 153 | Ga0466701_031264 | 3300042598 | Bacteria | 4756 |
| 154 | Ga0466706_052395 | 3300042599 | Bacteria | 3420 |
| 155 | Ga0466706_077425 | 3300042599 | Bacteria | 7493 |
| 156 | Ga0466713_029671 | 3300042602 | Bacteria | 2473 |
| 157 | Ga0466716_266440 | 3300042605 | Bacteria | 20602 |
| 158 | Ga0466722_074104 | 3300042609 | Bacteria | 13640 |
| 159 | 2227504633 | 2225789004 | Bacteria | 3712 |
| 160 | JGI24702J35022_10005244 | 3300002462 | Bacteria | 7600 |
| 161 | JGI24702J35022_10053545 | 3300002462 | Unclassified | 2152 |
| 162 | JGI24705J35276_12190370 | 3300002504 | Bacteria | 1462 |
| 163 | JGI24705J35276_12238474 | 3300002504 | Bacteria | 23401 |
| 164 | JGI24696J40584_12905839 | 3300002834 | Bacteria | 1217 |
| 165 | Ga0123357_10000199 | 3300009784 | Unclassified | 56476 |
| 166 | Ga0466703_048882 | 3300042636 | Bacteria | 42148 |
| 167 | Ga0466703_083824 | 3300042636 | Bacteria | 9106 |
| 168 | Ga0466704_187848 | 3300042643 | Unclassified | 6578 |
| 169 | Ga0466704_508701 | 3300042643 | Bacteria | 12981 |
| 170 | Ga0466708_367106 | 3300042652 | Bacteria | 72455 |
| 171 | Ga0466727_037398 | 3300042655 | Bacteria | 10654 |
| 172 | Ga0466715_252266 | 3300042616 | Bacteria | 20049 |
| 173 | Ga0466726_465323 | 3300042619 | Bacteria | 1345 |
| 174 | Ga0466705_106615 | 3300042612 | Bacteria | 5845 |
| 175 | Ga0123356_10023102 | 3300010049 | Bacteria | 5858 |
| 176 | Ga0123356_10388596 | 3300010049 | Bacteria | 1530 |
| 177 | Ga0123354_10022651 | 3300010882 | Bacteria | 9904 |
| 178 | Ga0466692_046888 | 3300042591 | Bacteria | 170448 |
| 179 | Ga0466696_180794 | 3300042596 | Bacteria | 1032 |
| 180 | Ga0466700_036108 | 3300042600 | Bacteria | 59458 |
| 181 | Ga0466707_083015 | 3300042601 | Bacteria | 7598 |
| 182 | Ga0466713_027912 | 3300042602 | Bacteria | 47751 |
| 183 | Ga0466716_047989 | 3300042605 | Bacteria | 8148 |
| 184 | Ga0466716_538009 | 3300042605 | Bacteria | 12312 |
| 185 | Ga0466721_283458 | 3300042608 | Bacteria | 1798 |
| 186 | Ga0466722_156510 | 3300042609 | Bacteria | 8187 |
| 187 | IMNBL1DRAFT_c0004750 | 3300000062 | Unclassified | 8030 |
| 188 | JGI24702J35022_10013900 | 3300002462 | Bacteria | 4449 |
| 189 | Ga0068305_10055120 | 3300005083 | Bacteria | 34511 |
| 190 | Ga0072940_1480621 | 3300005200 | Bacteria | 722 |
| 191 | Ga0072941_1514246 | 3300005201 | Bacteria | 952 |
| 192 | Ga0466731_026489 | 3300042622 | Bacteria | 1194 |
| 193 | Ga0466735_012763 | 3300042624 | Bacteria | 1079 |
| 194 | Ga0466735_043635 | 3300042624 | Bacteria | 2094 |
| 195 | Ga0466735_049562 | 3300042624 | Bacteria | 2382 |
| 196 | Ga0466735_096998 | 3300042624 | Bacteria | 6216 |
| 197 | Ga0466708_047153 | 3300042652 | Bacteria | 1628 |
| 198 | Ga0466727_100400 | 3300042655 | Bacteria | 3135 |
| 199 | Ga0466711_045786 | 3300042615 | Bacteria | 34187 |
| 200 | Ga0466711_064755 | 3300042615 | Bacteria | 3008 |
| 201 | Ga0466715_090076 | 3300042616 | Bacteria | 8188 |
| 202 | Ga0466715_109224 | 3300042616 | Bacteria | 75833 |
| 203 | Ga0466715_358480 | 3300042616 | Bacteria | 22766 |
| 204 | Ga0466715_430040 | 3300042616 | Bacteria | 4718 |
| 205 | Ga0466715_512092 | 3300042616 | Unclassified | 8004 |
| 206 | Ga0466723_137240 | 3300042618 | Bacteria | 37694 |
| 207 | Ga0466726_097898 | 3300042619 | Bacteria | 4058 |
| 208 | Ga0466705_204744 | 3300042612 | Bacteria | 2268 |
| 209 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 210 | Ga0123357_10025852 | 3300009784 | Bacteria | 7924 |
| 211 | Ga0123356_10855007 | 3300010049 | Bacteria | 1081 |
| 212 | Ga0123353_10789467 | 3300010167 | Bacteria | 1313 |
| 213 | Ga0466690_217677 | 3300042590 | Bacteria | 30896 |
| 214 | Ga0466690_218006 | 3300042590 | Unclassified | 6828 |
| 215 | Ga0466696_113216 | 3300042596 | Bacteria | 1274 |
| 216 | Ga0466696_201817 | 3300042596 | Bacteria | 41274 |
| 217 | Ga0466701_053293 | 3300042598 | Bacteria | 1334 |
| 218 | Ga0466706_202177 | 3300042599 | Bacteria | 14083 |
| 219 | Ga0466700_109395 | 3300042600 | Bacteria | 3245 |
| 220 | Ga0466713_124643 | 3300042602 | Bacteria | 27149 |
| 221 | Ga0466716_485525 | 3300042605 | Bacteria | 1948 |
| 222 | Ga0466719_075182 | 3300042606 | Bacteria | 1858 |
| 223 | Ga0466719_193720 | 3300042606 | Bacteria | 1151 |
| 224 | Ga0466697_014414 | 3300042611 | Bacteria | 1912 |
| 225 | JGI24702J35022_10002533 | 3300002462 | Bacteria | 11121 |
| 226 | Ga0466735_193702 | 3300042624 | Bacteria | 3516 |
| 227 | Ga0466703_032081 | 3300042636 | Bacteria | 17325 |
| 228 | Ga0466703_035653 | 3300042636 | Bacteria | 19648 |
| 229 | Ga0466703_044273 | 3300042636 | Bacteria | 12367 |
| 230 | Ga0466703_303409 | 3300042636 | Bacteria | 6910 |
| 231 | Ga0466709_279822 | 3300042648 | Bacteria | 3979 |
| 232 | Ga0466715_363889 | 3300042616 | Bacteria | 7282 |
| 233 | Ga0123356_10825283 | 3300010049 | Bacteria | 1098 |
| 234 | Ga0123354_10298329 | 3300010882 | Bacteria | 1530 |
| 235 | Ga0466692_015667 | 3300042591 | Bacteria | 10269 |
| 236 | Ga0466694_023749 | 3300042594 | Bacteria | 1330 |
| 237 | Ga0466696_016870 | 3300042596 | Bacteria | 18403 |
| 238 | Ga0466700_036331 | 3300042600 | Bacteria | 1851 |
| 239 | Ga0466700_371496 | 3300042600 | Bacteria | 1566 |
| 240 | Ga0466700_416529 | 3300042600 | Bacteria | 1263 |
| 241 | Ga0466707_228599 | 3300042601 | Bacteria | 5121 |
| 242 | Ga0466713_050998 | 3300042602 | Bacteria | 30502 |
| 243 | Ga0466716_041206 | 3300042605 | Bacteria | 12403 |
| 244 | Ga0466719_269215 | 3300042606 | Bacteria | 1397 |
| 245 | Ga0466722_157838 | 3300042609 | Bacteria | 26726 |
| 246 | 2227247446 | 2225789004 | Bacteria | 32460 |
| 247 | 2227510760 | 2225789004 | Bacteria | 18278 |
| 248 | IMNBL1DRAFT_c0008533 | 3300000062 | Bacteria | 5204 |
| 249 | JGI24702J35022_10002459 | 3300002462 | Bacteria | 11297 |
| 250 | JGI24702J35022_10060644 | 3300002462 | Bacteria | 2022 |
| 251 | JGI24705J35276_12234760 | 3300002504 | Bacteria | 5815 |
| 252 | JGI24699J35502_11134031 | 3300002509 | Bacteria | 25636 |
| 253 | Ga0123357_10000729 | 3300009784 | Bacteria | 33109 |
| 254 | Ga0466729_265829 | 3300042621 | Bacteria | 25507 |
| 255 | Ga0466735_009537 | 3300042624 | Bacteria | 1581 |
| 256 | Ga0466735_026922 | 3300042624 | Bacteria | 6280 |
| 257 | Ga0466735_155257 | 3300042624 | Bacteria | 8842 |
| 258 | Ga0466703_077722 | 3300042636 | Bacteria | 17217 |
| 259 | Ga0466703_419893 | 3300042636 | Bacteria | 9964 |
| 260 | Ga0466704_092032 | 3300042643 | Bacteria | 3788 |
| 261 | Ga0466704_278635 | 3300042643 | Bacteria | 1687 |
| 262 | Ga0466704_496402 | 3300042643 | Unclassified | 3807 |
| 263 | Ga0466704_554395 | 3300042643 | Bacteria | 25730 |
| 264 | Ga0466709_345480 | 3300042648 | Bacteria | 40527 |
| 265 | Ga0466727_008449 | 3300042655 | Bacteria | 2055 |
| 266 | Ga0466705_414545 | 3300042612 | Bacteria | 20973 |
| 267 | Ga0466711_175014 | 3300042615 | Bacteria | 7437 |
| 268 | Ga0466728_386646 | 3300042620 | Bacteria | 14940 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00677 | Lum_binding | Lumazine binding domain | 108 | 192 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.