Protein Family IF03833
Metagenome
Isolate
406
Members
117
Samples
368
Scaffolds
258.74
Avg Length
Representative Sequence
- ID
- 3300012837|Ga0160455_100168|Ga0160455_1001685
- Length
- 324 aa
- Sequence
- MKLNLKRPLAFFDLEATGTIIGFDRIVEIAVLKVFPDGSKEMKNARINPEMPIPLETSLIHGIYDEDIKDAPTFKQAGPEFAAFLDDCDLAGYNSNKFDIPMLMDEFLRAGVPFDIDNRKFVDVQNIFHQMEQRTLKAAYKFYCGKSLENAHNADADTMATYEVLLGQLERYKDVEFVDKKGNVSVPVKNDVDALHEFTNLHNPVDFAGRLVFNEQGVEVFNFGKHKGKCVEEVFQAEPSYYSWMQNGDFPLYTKKCLEKIWVRWNEKKVLVKKTTETKIEVESPRTVTPRKDNDTRPIFKKKESAAPVTDSMLDELKKKFGK*
Sample Types
Isolate
9.4%
Metagenome
90.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
22.5%
Blattidae
14.4%
Kalotermitidae
12.6%
Culicidae
9.0%
Elmidae
7.2%
Unclassified
6.3%
Formicidae
5.4%
Drosophilidae
4.5%
Termopsidae
3.6%
Armadillidiidae
3.6%
Rhinotermitidae
2.7%
Passalidae
1.8%
Delphacidae
0.9%
Hodotermitidae
0.9%
Hydrophilidae
0.9%
Daphniidae
0.9%
Pyroglyphidae
0.9%
Aphelinidae
0.9%
Cambaridae
0.9%
Taxonomy
Archaea
0
Bacteria
389
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 2 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 3 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 4 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 5 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 10 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 11 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 12 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 13 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 14 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 15 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 16 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 17 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 18 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 19 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 20 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 21 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 22 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 23 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 24 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 25 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 26 | 3000336795 | Cardinium endosymbiont of Sogatella furcifera cSfur | Isolate | Delphacidae |
| 27 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 28 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 29 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 30 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 31 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 32 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 33 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 34 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 35 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 36 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 37 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 38 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 39 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 40 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 41 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 42 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 43 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 44 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 45 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 46 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 47 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 48 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 49 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 50 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 51 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 52 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 53 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 54 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 55 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 56 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 57 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 58 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 59 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 60 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 61 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 62 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 63 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 64 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 65 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 66 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 67 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 68 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 69 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 70 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 71 | 3000153175 | Cardinium endosymbiont of Dermatophagoides farinae UMMZ BMOC 05-0812-001 | Isolate | Pyroglyphidae |
| 72 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 73 | 3300003131 | Encarsia pergandiella symbiont microbial communities from Weslaco, Texas | Metagenome | Aphelinidae |
| 74 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 75 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 76 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 77 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 78 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 79 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 80 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 81 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 82 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 83 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 84 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 85 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 86 | 3300005316 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut | Metagenome | Drosophilidae |
| 87 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 88 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 89 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 90 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 91 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 92 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 93 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 94 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 95 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 96 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 97 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 98 | 2998907766 | Penaeicola halotolerans LMIT005 | Isolate | |
| 99 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 100 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 101 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 102 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 103 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 104 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 105 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 106 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 107 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 108 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
| 109 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 110 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 111 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 112 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 113 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 114 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 115 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 116 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 117 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466723_137868 | 3300042618 | Bacteria | 7658 |
| 2 | Ga0466726_021927 | 3300042619 | Bacteria | 10677 |
| 3 | Ga0466726_081325 | 3300042619 | Bacteria | 12183 |
| 4 | Ga0466726_294712 | 3300042619 | Bacteria | 4755 |
| 5 | Ga0466705_226040 | 3300042612 | Bacteria | 8446 |
| 6 | Ga0466705_351700 | 3300042612 | Bacteria | 17139 |
| 7 | 2227344678 | 2225789004 | Bacteria | 6221 |
| 8 | IMNBL1DRAFT_c0004497 | 3300000062 | Bacteria | 8344 |
| 9 | IMNBL1DRAFT_c0011574 | 3300000062 | Bacteria | 4112 |
| 10 | IMNBL1DRAFT_c0055349 | 3300000062 | Bacteria | 1224 |
| 11 | Ga0068305_10070753 | 3300005083 | Bacteria | 8625 |
| 12 | Ga0072941_1015407 | 3300005201 | Bacteria | 4683 |
| 13 | Ga0104048_1022272 | 3300007143 | Unclassified | 7387 |
| 14 | Ga0104050_1001574 | 3300007153 | Bacteria | 3986 |
| 15 | Ga0103264_1000022 | 3300007188 | Bacteria | 178022 |
| 16 | Ga0466690_035035 | 3300042590 | Bacteria | 7256 |
| 17 | Ga0466690_276223 | 3300042590 | Bacteria | 213056 |
| 18 | Ga0466690_309291 | 3300042590 | Bacteria | 26834 |
| 19 | Ga0466692_054187 | 3300042591 | Bacteria | 12714 |
| 20 | Ga0466694_066036 | 3300042594 | Bacteria | 3117 |
| 21 | Ga0466696_010546 | 3300042596 | Bacteria | 6133 |
| 22 | Ga0466696_078846 | 3300042596 | Bacteria | 1525 |
| 23 | Ga0123355_10143753 | 3300009826 | Bacteria | 3643 |
| 24 | Ga0123356_10024068 | 3300010049 | Bacteria | 5732 |
| 25 | Ga0123353_10065628 | 3300010167 | Bacteria | 5828 |
| 26 | Ga0123353_10170571 | 3300010167 | Bacteria | 3454 |
| 27 | Ga0123354_10001055 | 3300010882 | Bacteria | 31731 |
| 28 | Ga0123354_10202565 | 3300010882 | Bacteria | 2176 |
| 29 | Ga0123354_10329157 | 3300010882 | Bacteria | 1396 |
| 30 | Ga0466701_032214 | 3300042598 | Bacteria | 43207 |
| 31 | Ga0466701_033049 | 3300042598 | Bacteria | 2505 |
| 32 | Ga0466701_102428 | 3300042598 | Bacteria | 44442 |
| 33 | Ga0466706_071532 | 3300042599 | Bacteria | 22220 |
| 34 | Ga0466706_154787 | 3300042599 | Unclassified | 1081 |
| 35 | Ga0466706_269132 | 3300042599 | Bacteria | 1562 |
| 36 | Ga0466700_425448 | 3300042600 | Bacteria | 2346 |
| 37 | Ga0466707_163242 | 3300042601 | Bacteria | 1214 |
| 38 | Ga0466713_012145 | 3300042602 | Bacteria | 43474 |
| 39 | Ga0466713_099716 | 3300042602 | Bacteria | 24500 |
| 40 | Ga0466713_115233 | 3300042602 | Bacteria | 28611 |
| 41 | Ga0466713_132210 | 3300042602 | Bacteria | 46954 |
| 42 | Ga0466714_081810 | 3300042603 | Bacteria | 2793 |
| 43 | Ga0466716_102860 | 3300042605 | Bacteria | 7682 |
| 44 | Ga0466716_256212 | 3300042605 | Bacteria | 4943 |
| 45 | Ga0466719_282293 | 3300042606 | Bacteria | 5829 |
| 46 | Ga0466719_303945 | 3300042606 | Bacteria | 21889 |
| 47 | Ga0466722_084826 | 3300042609 | Bacteria | 2766 |
| 48 | Ga0466722_266222 | 3300042609 | Bacteria | 11755 |
| 49 | Ga0466735_112809 | 3300042624 | Bacteria | 5593 |
| 50 | Ga0466735_145772 | 3300042624 | Bacteria | 2686 |
| 51 | Ga0466730_097984 | 3300042625 | Bacteria | 727286 |
| 52 | Ga0466703_421965 | 3300042636 | Bacteria | 9078 |
| 53 | Ga0466704_072664 | 3300042643 | Bacteria | 13812 |
| 54 | Ga0466704_165577 | 3300042643 | Bacteria | 8486 |
| 55 | Ga0466704_536150 | 3300042643 | Bacteria | 4736 |
| 56 | Ga0466724_28381 | 3300042649 | Bacteria | 68129 |
| 57 | Ga0466724_43696 | 3300042649 | Bacteria | 561295 |
| 58 | Ga0466727_210639 | 3300042655 | Bacteria | 23496 |
| 59 | Ga0466711_008524 | 3300042615 | Unclassified | 1517 |
| 60 | Ga0466711_135661 | 3300042615 | Bacteria | 2025 |
| 61 | Ga0466711_240969 | 3300042615 | Bacteria | 7232 |
| 62 | Ga0466715_066146 | 3300042616 | Bacteria | 20129 |
| 63 | Ga0466715_087433 | 3300042616 | Bacteria | 28443 |
| 64 | Ga0466715_468054 | 3300042616 | Bacteria | 39701 |
| 65 | Ga0466723_250641 | 3300042618 | Bacteria | 2637 |
| 66 | Ga0466726_328888 | 3300042619 | Bacteria | 4079 |
| 67 | Ga0466728_200547 | 3300042620 | Bacteria | 11228 |
| 68 | IMNBL1DRAFT_c0001371 | 3300000062 | Bacteria | 18314 |
| 69 | IMNBL1DRAFT_c0006017 | 3300000062 | Bacteria | 6764 |
| 70 | JGI24702J35022_10025522 | 3300002462 | Bacteria | 3188 |
| 71 | JGI24699J35502_11028272 | 3300002509 | Bacteria | 1494 |
| 72 | JGI24699J35502_11134100 | 3300002509 | Bacteria | 30804 |
| 73 | Ga0052165_100011 | 3300003131 | Bacteria | 19495 |
| 74 | Ga0068302_10152344 | 3300005071 | Bacteria | 5283 |
| 75 | Ga0068302_10257965 | 3300005071 | Bacteria | 2070 |
| 76 | Ga0104048_1020014 | 3300007143 | Unclassified | 1708 |
| 77 | Ga0160460_100032 | 3300012845 | Bacteria | 316932 |
| 78 | Ga0160435_1000007 | 3300012857 | Unclassified | 269526 |
| 79 | Ga0466690_218956 | 3300042590 | Bacteria | 9965 |
| 80 | Ga0466690_403369 | 3300042590 | Bacteria | 6141 |
| 81 | Ga0466693_226172 | 3300042592 | Bacteria | 1919 |
| 82 | Ga0466691_023858 | 3300042593 | Bacteria | 13253 |
| 83 | Ga0466691_097455 | 3300042593 | Bacteria | 32144 |
| 84 | Ga0466691_128298 | 3300042593 | Bacteria | 15773 |
| 85 | Ga0466696_019438 | 3300042596 | Bacteria | 1567 |
| 86 | Ga0466696_046481 | 3300042596 | Bacteria | 9675 |
| 87 | Ga0466696_166515 | 3300042596 | Bacteria | 2849 |
| 88 | Ga0123357_10014799 | 3300009784 | Bacteria | 10199 |
| 89 | Ga0466707_064540 | 3300042601 | Bacteria | 6487 |
| 90 | Ga0466707_301453 | 3300042601 | Bacteria | 14839 |
| 91 | Ga0466714_009266 | 3300042603 | Bacteria | 25729 |
| 92 | Ga0466714_163273 | 3300042603 | Bacteria | 2481 |
| 93 | Ga0466716_073567 | 3300042605 | Bacteria | 13972 |
| 94 | Ga0466722_066324 | 3300042609 | Bacteria | 41323 |
| 95 | Ga0466734_143514 | 3300042623 | Bacteria | 1138 |
| 96 | Ga0466735_028619 | 3300042624 | Bacteria | 1331 |
| 97 | Ga0466735_066144 | 3300042624 | Bacteria | 1655 |
| 98 | Ga0466735_112070 | 3300042624 | Bacteria | 4737 |
| 99 | Ga0466735_118285 | 3300042624 | Bacteria | 8233 |
| 100 | Ga0466735_224037 | 3300042624 | Bacteria | 1247 |
| 101 | Ga0466704_039096 | 3300042643 | Bacteria | 19109 |
| 102 | Ga0466704_268287 | 3300042643 | Bacteria | 2324 |
| 103 | Ga0466704_288938 | 3300042643 | Bacteria | 7496 |
| 104 | Ga0466724_18164 | 3300042649 | Unclassified | 19706 |
| 105 | Ga0466725_297803 | 3300042654 | Bacteria | 25445 |
| 106 | Ga0466725_425080 | 3300042654 | Bacteria | 39967 |
| 107 | Ga0466727_218918 | 3300042655 | Bacteria | 13170 |
| 108 | Ga0466711_259192 | 3300042615 | Bacteria | 8724 |
| 109 | Ga0466715_127650 | 3300042616 | Bacteria | 20292 |
| 110 | Ga0466715_234297 | 3300042616 | Bacteria | 23273 |
| 111 | Ga0466715_553479 | 3300042616 | Bacteria | 7519 |
| 112 | Ga0466718_152114 | 3300042617 | Bacteria | 1023 |
| 113 | Ga0466728_242816 | 3300042620 | Bacteria | 11602 |
| 114 | Ga0466729_188785 | 3300042621 | Bacteria | 9694 |
| 115 | Ga0466733_080280 | 3300042659 | Bacteria | 2282 |
| 116 | 2227128034 | 2225789004 | Bacteria | 9011 |
| 117 | 2227361377 | 2225789004 | Bacteria | 6087 |
| 118 | JGI24702J35022_10000410 | 3300002462 | Bacteria | 25605 |
| 119 | JGI24702J35022_10031800 | 3300002462 | Bacteria | 2826 |
| 120 | JGI24702J35022_10209830 | 3300002462 | Bacteria | 1118 |
| 121 | Ga0068305_10002699 | 3300005083 | Bacteria | 13227 |
| 122 | Ga0160445_100247 | 3300012847 | Bacteria | 38666 |
| 123 | Ga0466692_136237 | 3300042591 | Bacteria | 11500 |
| 124 | Ga0466693_267335 | 3300042592 | Bacteria | 2613 |
| 125 | Ga0466691_014851 | 3300042593 | Bacteria | 13862 |
| 126 | Ga0466696_140182 | 3300042596 | Bacteria | 8552 |
| 127 | Ga0466696_277790 | 3300042596 | Bacteria | 3611 |
| 128 | Ga0466696_435367 | 3300042596 | Bacteria | 3643 |
| 129 | Ga0123357_10018524 | 3300009784 | Bacteria | 9259 |
| 130 | Ga0123357_10021260 | 3300009784 | Bacteria | 8687 |
| 131 | Ga0123357_10133865 | 3300009784 | Bacteria | 3074 |
| 132 | Ga0123357_10448164 | 3300009784 | Bacteria | 1123 |
| 133 | Ga0123353_10211000 | 3300010167 | Bacteria | 3046 |
| 134 | Ga0466707_058340 | 3300042601 | Bacteria | 2510 |
| 135 | Ga0466707_254121 | 3300042601 | Bacteria | 9455 |
| 136 | Ga0466707_260913 | 3300042601 | Bacteria | 1792 |
| 137 | Ga0466707_297094 | 3300042601 | Bacteria | 4597 |
| 138 | Ga0466707_339007 | 3300042601 | Bacteria | 6429 |
| 139 | Ga0466714_165529 | 3300042603 | Bacteria | 3725 |
| 140 | Ga0466719_025468 | 3300042606 | Bacteria | 4125 |
| 141 | Ga0466719_399603 | 3300042606 | Bacteria | 12646 |
| 142 | Ga0466719_434603 | 3300042606 | Bacteria | 3443 |
| 143 | Ga0466722_187255 | 3300042609 | Bacteria | 11075 |
| 144 | Ga0466729_271082 | 3300042621 | Bacteria | 5557 |
| 145 | Ga0466730_030722 | 3300042625 | Bacteria | 1135247 |
| 146 | Ga0466703_034498 | 3300042636 | Bacteria | 2650 |
| 147 | Ga0466703_177758 | 3300042636 | Bacteria | 25094 |
| 148 | Ga0466724_43312 | 3300042649 | Unclassified | 35690 |
| 149 | Ga0466727_041976 | 3300042655 | Bacteria | 33578 |
| 150 | Ga0466727_044277 | 3300042655 | Bacteria | 7771 |
| 151 | Ga0466727_194949 | 3300042655 | Bacteria | 20487 |
| 152 | Ga0466705_501169 | 3300042612 | Bacteria | 5012 |
| 153 | Ga0466711_184442 | 3300042615 | Bacteria | 5940 |
| 154 | Ga0466711_323206 | 3300042615 | Bacteria | 3194 |
| 155 | Ga0466711_376448 | 3300042615 | Bacteria | 1656 |
| 156 | Ga0466715_090921 | 3300042616 | Bacteria | 11800 |
| 157 | Ga0466723_141127 | 3300042618 | Bacteria | 3873 |
| 158 | Ga0466728_156095 | 3300042620 | Bacteria | 3600 |
| 159 | Ga0466728_404970 | 3300042620 | Bacteria | 46041 |
| 160 | Ga0466729_116828 | 3300042621 | Bacteria | 15216 |
| 161 | IMNBL1DRAFT_c0009953 | 3300000062 | Bacteria | 4618 |
| 162 | IMNBL1DRAFT_c0079648 | 3300000062 | Bacteria | 921 |
| 163 | JGI24702J35022_10009022 | 3300002462 | Bacteria | 5619 |
| 164 | JGI24699J35502_11134218 | 3300002509 | Bacteria | 66161 |
| 165 | Ga0068305_10017541 | 3300005083 | Bacteria | 7947 |
| 166 | Ga0103267_1000308 | 3300007190 | Bacteria | 17559 |
| 167 | Ga0160440_101175 | 3300012815 | Unclassified | 3840 |
| 168 | Ga0160472_101481 | 3300012839 | Bacteria | 6809 |
| 169 | Ga0160443_100008 | 3300012848 | Bacteria | 615500 |
| 170 | Ga0466690_289464 | 3300042590 | Bacteria | 5737 |
| 171 | Ga0466692_193310 | 3300042591 | Bacteria | 49575 |
| 172 | Ga0466691_012115 | 3300042593 | Bacteria | 17649 |
| 173 | Ga0466701_014588 | 3300042598 | Bacteria | 14559 |
| 174 | Ga0123357_10008934 | 3300009784 | Bacteria | 12591 |
| 175 | Ga0123357_10018314 | 3300009784 | Bacteria | 9306 |
| 176 | Ga0123357_10045723 | 3300009784 | Bacteria | 5938 |
| 177 | Ga0123356_10013528 | 3300010049 | Bacteria | 7872 |
| 178 | Ga0160464_105949 | 3300012805 | Bacteria | 1357 |
| 179 | Ga0466707_124576 | 3300042601 | Bacteria | 23542 |
| 180 | Ga0466713_064234 | 3300042602 | Bacteria | 7519 |
| 181 | Ga0466714_041819 | 3300042603 | Bacteria | 104465 |
| 182 | Ga0466714_150303 | 3300042603 | Bacteria | 28075 |
| 183 | Ga0466716_116764 | 3300042605 | Bacteria | 19942 |
| 184 | Ga0466719_143659 | 3300042606 | Bacteria | 4357 |
| 185 | Ga0466722_050554 | 3300042609 | Bacteria | 3939 |
| 186 | Ga0466722_096452 | 3300042609 | Bacteria | 12880 |
| 187 | Ga0466722_203823 | 3300042609 | Bacteria | 26562 |
| 188 | Ga0466703_166876 | 3300042636 | Bacteria | 14308 |
| 189 | Ga0466703_359395 | 3300042636 | Bacteria | 13580 |
| 190 | Ga0466704_175561 | 3300042643 | Bacteria | 14634 |
| 191 | Ga0466709_215085 | 3300042648 | Bacteria | 10147 |
| 192 | Ga0466708_069911 | 3300042652 | Bacteria | 13157 |
| 193 | Ga0466725_311188 | 3300042654 | Bacteria | 11217 |
| 194 | Ga0466727_062038 | 3300042655 | Bacteria | 3805 |
| 195 | Ga0466711_093803 | 3300042615 | Bacteria | 25402 |
| 196 | Ga0466715_085911 | 3300042616 | Bacteria | 54416 |
| 197 | Ga0466715_426091 | 3300042616 | Bacteria | 11866 |
| 198 | Ga0466723_140798 | 3300042618 | Bacteria | 5839 |
| 199 | Ga0466726_032938 | 3300042619 | Bacteria | 39699 |
| 200 | Ga0466728_221899 | 3300042620 | Bacteria | 10062 |
| 201 | Ga0466705_017856 | 3300042612 | Bacteria | 8827 |
| 202 | Ga0466705_313939 | 3300042612 | Bacteria | 33682 |
| 203 | Ga0466705_329308 | 3300042612 | Bacteria | 3291 |
| 204 | Ga0466733_026093 | 3300042659 | Bacteria | 3466 |
| 205 | Ga0466733_156576 | 3300042659 | Bacteria | 2758 |
| 206 | 2227465749 | 2225789004 | Bacteria | 5170 |
| 207 | IMNBL1DRAFT_c0002523 | 3300000062 | Unclassified | 12677 |
| 208 | JGI24702J35022_10265291 | 3300002462 | Bacteria | 1003 |
| 209 | Meta3P_1002350 | 3300002464 | Unclassified | 10565 |
| 210 | JGI24705J35276_12206071 | 3300002504 | Bacteria | 1712 |
| 211 | Ga0104045_1076537 | 3300007085 | Bacteria | 1667 |
| 212 | Ga0123357_10001682 | 3300009784 | Bacteria | 23806 |
| 213 | Ga0160470_100832 | 3300012813 | Bacteria | 9215 |
| 214 | Ga0466692_092133 | 3300042591 | Bacteria | 23837 |
| 215 | Ga0466696_253210 | 3300042596 | Bacteria | 201850 |
| 216 | Ga0466696_331279 | 3300042596 | Bacteria | 5611 |
| 217 | Ga0466696_470316 | 3300042596 | Bacteria | 5614 |
| 218 | Ga0123357_10125341 | 3300009784 | Bacteria | 3219 |
| 219 | Ga0466701_096044 | 3300042598 | Bacteria | 212143 |
| 220 | Ga0466707_056555 | 3300042601 | Bacteria | 8162 |
| 221 | Ga0466707_191904 | 3300042601 | Bacteria | 5003 |
| 222 | Ga0466713_081632 | 3300042602 | Bacteria | 8129 |
| 223 | Ga0466713_118304 | 3300042602 | Bacteria | 7326 |
| 224 | Ga0466716_349846 | 3300042605 | Bacteria | 13854 |
| 225 | Ga0466719_143847 | 3300042606 | Bacteria | 15783 |
| 226 | Ga0466703_027299 | 3300042636 | Bacteria | 10951 |
| 227 | Ga0466703_221509 | 3300042636 | Bacteria | 34236 |
| 228 | Ga0466704_253317 | 3300042643 | Bacteria | 5002 |
| 229 | Ga0466704_443103 | 3300042643 | Bacteria | 3887 |
| 230 | Ga0466709_099936 | 3300042648 | Bacteria | 10023 |
| 231 | Ga0466708_040867 | 3300042652 | Bacteria | 27776 |
| 232 | Ga0466727_027589 | 3300042655 | Bacteria | 4487 |
| 233 | Ga0466727_141033 | 3300042655 | Bacteria | 10075 |
| 234 | Ga0466710_417285 | 3300042613 | Bacteria | 4061 |
| 235 | Ga0466715_010035 | 3300042616 | Bacteria | 38083 |
| 236 | Ga0466715_030640 | 3300042616 | Bacteria | 2901 |
| 237 | Ga0466723_332100 | 3300042618 | Bacteria | 4735 |
| 238 | Ga0466723_358056 | 3300042618 | Unclassified | 10392 |
| 239 | Ga0466705_100321 | 3300042612 | Bacteria | 2072 |
| 240 | Ga0466705_277955 | 3300042612 | Bacteria | 13235 |
| 241 | Ga0466733_038690 | 3300042659 | Bacteria | 100300 |
| 242 | Ga0466733_212103 | 3300042659 | Bacteria | 23699 |
| 243 | 2227286349 | 2225789004 | Bacteria | 6762 |
| 244 | 2227540478 | 2225789004 | Bacteria | 2997 |
| 245 | IMNBL1DRAFT_c0021247 | 3300000062 | Unclassified | 2603 |
| 246 | JGI24699J35502_11134148 | 3300002509 | Bacteria | 37810 |
| 247 | Ga0068305_10017932 | 3300005083 | Bacteria | 13068 |
| 248 | Ga0102736_1000034 | 3300007052 | Bacteria | 55263 |
| 249 | Ga0103268_1010815 | 3300007192 | Bacteria | 1915 |
| 250 | Ga0265387_1000548 | 3300024582 | Bacteria | 5923 |
| 251 | Ga0466690_124251 | 3300042590 | Bacteria | 8184 |
| 252 | Ga0466690_378352 | 3300042590 | Bacteria | 14565 |
| 253 | Ga0466692_042688 | 3300042591 | Bacteria | 33654 |
| 254 | Ga0466692_135353 | 3300042591 | Bacteria | 2200 |
| 255 | Ga0466691_089972 | 3300042593 | Bacteria | 7881 |
| 256 | Ga0466699_426866 | 3300042597 | Bacteria | 1023 |
| 257 | Ga0466701_002890 | 3300042598 | Bacteria | 12408 |
| 258 | Ga0123357_10132378 | 3300009784 | Bacteria | 3099 |
| 259 | Ga0123356_10186943 | 3300010049 | Bacteria | 2099 |
| 260 | Ga0123353_10000041 | 3300010167 | Bacteria | 137212 |
| 261 | Ga0123353_10591804 | 3300010167 | Bacteria | 1588 |
| 262 | Ga0123354_10000641 | 3300010882 | Bacteria | 36828 |
| 263 | Ga0123354_10003559 | 3300010882 | Bacteria | 21570 |
| 264 | Ga0123354_10059080 | 3300010882 | Unclassified | 5690 |
| 265 | Ga0466706_014133 | 3300042599 | Bacteria | 19194 |
| 266 | Ga0466706_035124 | 3300042599 | Bacteria | 61315 |
| 267 | Ga0466706_155043 | 3300042599 | Unclassified | 1184 |
| 268 | Ga0466707_047616 | 3300042601 | Bacteria | 20965 |
| 269 | Ga0466714_029794 | 3300042603 | Bacteria | 42861 |
| 270 | Ga0466719_327343 | 3300042606 | Bacteria | 2668 |
| 271 | Ga0466722_209447 | 3300042609 | Bacteria | 25046 |
| 272 | Ga0466722_252821 | 3300042609 | Bacteria | 235840 |
| 273 | Ga0466729_230083 | 3300042621 | Bacteria | 2128 |
| 274 | Ga0466734_142391 | 3300042623 | Bacteria | 1059 |
| 275 | Ga0466735_036328 | 3300042624 | Bacteria | 5654 |
| 276 | Ga0466735_054276 | 3300042624 | Bacteria | 2417 |
| 277 | Ga0466703_046793 | 3300042636 | Bacteria | 1604 |
| 278 | Ga0466703_092516 | 3300042636 | Bacteria | 23384 |
| 279 | Ga0466703_120196 | 3300042636 | Bacteria | 8565 |
| 280 | Ga0466703_410435 | 3300042636 | Bacteria | 13859 |
| 281 | Ga0466704_051910 | 3300042643 | Bacteria | 10915 |
| 282 | Ga0466709_396056 | 3300042648 | Bacteria | 40552 |
| 283 | Ga0466724_13166 | 3300042649 | Bacteria | 142311 |
| 284 | Ga0466727_142679 | 3300042655 | Bacteria | 6042 |
| 285 | Ga0466711_009583 | 3300042615 | Bacteria | 1517 |
| 286 | Ga0466711_090299 | 3300042615 | Bacteria | 47995 |
| 287 | Ga0466711_097396 | 3300042615 | Bacteria | 1795 |
| 288 | Ga0466711_243391 | 3300042615 | Unclassified | 4490 |
| 289 | Ga0466711_290361 | 3300042615 | Bacteria | 2573 |
| 290 | Ga0466715_194192 | 3300042616 | Bacteria | 7344 |
| 291 | Ga0466723_225795 | 3300042618 | Bacteria | 13841 |
| 292 | Ga0466728_222413 | 3300042620 | Bacteria | 18136 |
| 293 | Ga0466729_170334 | 3300042621 | Bacteria | 11027 |
| 294 | Ga0466733_010468 | 3300042659 | Bacteria | 13856 |
| 295 | IMNBL1DRAFT_c0002818 | 3300000062 | Bacteria | 11728 |
| 296 | JGI24702J35022_10001206 | 3300002462 | Bacteria | 16080 |
| 297 | JGI24705J35276_12220383 | 3300002504 | Bacteria | 2264 |
| 298 | JGI24696J40584_12941766 | 3300002834 | Bacteria | 1719 |
| 299 | Ga0466657_076183 | 3300042582 | Bacteria | 1031 |
| 300 | Ga0466690_027177 | 3300042590 | Bacteria | 32769 |
| 301 | Ga0466690_223698 | 3300042590 | Bacteria | 3031 |
| 302 | Ga0466690_421784 | 3300042590 | Bacteria | 2234 |
| 303 | Ga0123357_10007571 | 3300009784 | Bacteria | 13441 |
| 304 | Ga0123357_10046079 | 3300009784 | Bacteria | 5914 |
| 305 | Ga0123357_10157910 | 3300009784 | Bacteria | 2729 |
| 306 | Ga0123354_10000042 | 3300010882 | Bacteria | 95103 |
| 307 | Ga0466706_093516 | 3300042599 | Bacteria | 5540 |
| 308 | Ga0466706_275766 | 3300042599 | Bacteria | 6742 |
| 309 | Ga0466700_271005 | 3300042600 | Bacteria | 7253 |
| 310 | Ga0466700_373334 | 3300042600 | Bacteria | 80469 |
| 311 | Ga0466714_051789 | 3300042603 | Bacteria | 2773 |
| 312 | Ga0466714_054269 | 3300042603 | Bacteria | 2644 |
| 313 | Ga0466714_121039 | 3300042603 | Bacteria | 2824 |
| 314 | Ga0466714_140143 | 3300042603 | Bacteria | 3498 |
| 315 | Ga0466717_157090 | 3300042604 | Bacteria | 2401 |
| 316 | Ga0466722_110099 | 3300042609 | Bacteria | 3107 |
| 317 | Ga0466722_216541 | 3300042609 | Bacteria | 1681 |
| 318 | Ga0466698_029784 | 3300042610 | Bacteria | 1684 |
| 319 | Ga0466703_007766 | 3300042636 | Bacteria | 11395 |
| 320 | Ga0466703_008945 | 3300042636 | Bacteria | 15665 |
| 321 | Ga0466708_298706 | 3300042652 | Bacteria | 13911 |
| 322 | Ga0466708_422671 | 3300042652 | Bacteria | 12116 |
| 323 | Ga0466715_417726 | 3300042616 | Bacteria | 5721 |
| 324 | Ga0466715_584495 | 3300042616 | Bacteria | 8710 |
| 325 | Ga0466726_238478 | 3300042619 | Bacteria | 6103 |
| 326 | Ga0466728_312262 | 3300042620 | Bacteria | 1684 |
| 327 | Ga0466729_065131 | 3300042621 | Bacteria | 3231 |
| 328 | Ga0466705_032507 | 3300042612 | Bacteria | 27092 |
| 329 | Ga0466705_284900 | 3300042612 | Bacteria | 5027 |
| 330 | Ga0466705_378056 | 3300042612 | Bacteria | 11596 |
| 331 | Ga0068305_10501874 | 3300005083 | Bacteria | 5290 |
| 332 | Ga0074302_1136903 | 3300005316 | Bacteria | 1663 |
| 333 | Ga0103265_1000007 | 3300007068 | Bacteria | 131664 |
| 334 | Ga0104045_1022004 | 3300007085 | Unclassified | 1801 |
| 335 | Ga0102734_1000077 | 3300007129 | Bacteria | 70866 |
| 336 | Ga0104019_1001214 | 3300007150 | Bacteria | 9340 |
| 337 | Ga0160441_100889 | 3300012825 | Bacteria | 14393 |
| 338 | Ga0160455_100168 | 3300012837 | Bacteria | 70703 |
| 339 | Ga0160433_100246 | 3300012846 | Bacteria | 38192 |
| 340 | Ga0160434_100083 | 3300012850 | Unclassified | 63208 |
| 341 | Ga0466690_177182 | 3300042590 | Bacteria | 15895 |
| 342 | Ga0466691_019050 | 3300042593 | Bacteria | 28586 |
| 343 | Ga0466691_140180 | 3300042593 | Bacteria | 12996 |
| 344 | Ga0466696_503453 | 3300042596 | Bacteria | 10294 |
| 345 | Ga0466699_052727 | 3300042597 | Bacteria | 1373 |
| 346 | Ga0123357_10414325 | 3300009784 | Bacteria | 1210 |
| 347 | Ga0123354_10017632 | 3300010882 | Bacteria | 11188 |
| 348 | Ga0466706_025174 | 3300042599 | Bacteria | 118676 |
| 349 | Ga0466706_054207 | 3300042599 | Bacteria | 1989 |
| 350 | Ga0466707_305252 | 3300042601 | Bacteria | 3147 |
| 351 | Ga0466713_009775 | 3300042602 | Bacteria | 66246 |
| 352 | Ga0466713_023394 | 3300042602 | Bacteria | 7460 |
| 353 | Ga0466713_034984 | 3300042602 | Bacteria | 13477 |
| 354 | Ga0466713_124591 | 3300042602 | Bacteria | 15803 |
| 355 | Ga0466716_397792 | 3300042605 | Bacteria | 16628 |
| 356 | Ga0466719_053145 | 3300042606 | Bacteria | 15783 |
| 357 | Ga0466734_014088 | 3300042623 | Bacteria | 1981 |
| 358 | Ga0466703_099136 | 3300042636 | Bacteria | 1335 |
| 359 | Ga0466703_269490 | 3300042636 | Bacteria | 1686 |
| 360 | Ga0466704_142162 | 3300042643 | Bacteria | 7889 |
| 361 | Ga0466704_151538 | 3300042643 | Bacteria | 8003 |
| 362 | Ga0466704_195822 | 3300042643 | Bacteria | 13956 |
| 363 | Ga0466704_207722 | 3300042643 | Bacteria | 9000 |
| 364 | Ga0466704_362592 | 3300042643 | Bacteria | 6525 |
| 365 | Ga0466709_183247 | 3300042648 | Bacteria | 3970 |
| 366 | Ga0466709_369756 | 3300042648 | Bacteria | 11117 |
| 367 | Ga0466708_082974 | 3300042652 | Bacteria | 13466 |
| 368 | Ga0466727_036553 | 3300042655 | Bacteria | 2158 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.