Protein Family IF03491
Metagenome
Isolate
132
Members
50
Samples
124
Scaffolds
108.58
Avg Length
Representative Sequence
- ID
- 3300010882|Ga0123354_10057907|Ga0123354_100579071
- Length
- 126 aa
- Sequence
- VGNIKNCSYICSEKGKAMRKANIYYNGILTGELTEISRKEYLFKYDDNYFMDTSKPAISLNLPKTRQEYRSAHLFPFFFNMLSEGSNRATQSRLLRIDEKDHFGILLATAQHDVIGAVTVKPVTQ*
Sample Types
Isolate
6.1%
Metagenome
93.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.5%
Kalotermitidae
22.9%
Unclassified
10.4%
Blattidae
6.2%
Rhinotermitidae
6.2%
Termopsidae
6.2%
Passalidae
4.2%
Hodotermitidae
2.1%
Elmidae
2.1%
Kiwaidae
2.1%
Taxonomy
Archaea
0
Bacteria
125
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 12 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 13 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 14 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 15 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 16 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 17 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 18 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 19 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 20 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 21 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 22 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 23 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 24 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 25 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 26 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 27 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 28 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 29 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 30 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 31 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 32 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 33 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 34 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 35 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 36 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 37 | 2820765201 | Unclassified Bacteroidetes Lab288P3bin82 | Isolate | Unclassified |
| 38 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 39 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 40 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 41 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 42 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 43 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 44 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 45 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 46 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 47 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 48 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 49 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 50 | 3300013007 | Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts | Metagenome | Kiwaidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_072382 | 3300042611 | Bacteria | 2273 |
| 2 | Ga0466733_181724 | 3300042659 | Bacteria | 66237 |
| 3 | Ga0157631_136453 | 3300013007 | Bacteria | 2039 |
| 4 | Ga0466695_237156 | 3300042595 | Bacteria | 1275 |
| 5 | Ga0123356_10405353 | 3300010049 | Unclassified | 1502 |
| 6 | Ga0123356_10598979 | 3300010049 | Bacteria | 1267 |
| 7 | Ga0123354_10163584 | 3300010882 | Bacteria | 2627 |
| 8 | Ga0466710_049789 | 3300042613 | Bacteria | 1093 |
| 9 | Ga0466726_193435 | 3300042619 | Bacteria | 2269 |
| 10 | Ga0466726_375248 | 3300042619 | Bacteria | 1198 |
| 11 | JGI24702J35022_10150857 | 3300002462 | Bacteria | 1304 |
| 12 | Ga0466735_091666 | 3300042624 | Bacteria | 4215 |
| 13 | Ga0466735_135665 | 3300042624 | Bacteria | 1199 |
| 14 | Ga0466727_125799 | 3300042655 | Bacteria | 12931 |
| 15 | Ga0466706_225194 | 3300042599 | Bacteria | 1531 |
| 16 | Ga0466707_198402 | 3300042601 | Bacteria | 7427 |
| 17 | Ga0466733_080583 | 3300042659 | Bacteria | 5055 |
| 18 | Ga0466733_167058 | 3300042659 | Bacteria | 1025 |
| 19 | Ga0466691_012684 | 3300042593 | Bacteria | 8533 |
| 20 | Ga0466694_106519 | 3300042594 | Bacteria | 2288 |
| 21 | Ga0466696_200041 | 3300042596 | Bacteria | 4187 |
| 22 | Ga0123355_10275670 | 3300009826 | Bacteria | 2329 |
| 23 | Ga0123354_10000257 | 3300010882 | Bacteria | 47636 |
| 24 | Ga0466711_065196 | 3300042615 | Bacteria | 5780 |
| 25 | Ga0466704_073120 | 3300042643 | Bacteria | 2111 |
| 26 | Ga0466704_274621 | 3300042643 | Bacteria | 8118 |
| 27 | Ga0466709_027161 | 3300042648 | Bacteria | 5991 |
| 28 | Ga0466708_141400 | 3300042652 | Bacteria | 2181 |
| 29 | Ga0466707_038398 | 3300042601 | Bacteria | 2088 |
| 30 | Ga0466707_070043 | 3300042601 | Bacteria | 1921 |
| 31 | Ga0466707_295888 | 3300042601 | Bacteria | 2365 |
| 32 | Ga0466707_358689 | 3300042601 | Bacteria | 1090 |
| 33 | Ga0466707_420009 | 3300042601 | Bacteria | 12228 |
| 34 | Ga0466714_011714 | 3300042603 | Bacteria | 47582 |
| 35 | Ga0466714_135691 | 3300042603 | Bacteria | 1435 |
| 36 | Ga0466694_254677 | 3300042594 | Bacteria | 1059 |
| 37 | Ga0123357_10055515 | 3300009784 | Bacteria | 5331 |
| 38 | Ga0123357_10773785 | 3300009784 | Bacteria | 659 |
| 39 | Ga0123356_10072417 | 3300010049 | Bacteria | 3238 |
| 40 | Ga0123356_12426204 | 3300010049 | Bacteria | 656 |
| 41 | Ga0123354_10017662 | 3300010882 | Bacteria | 11180 |
| 42 | Ga0123354_10175618 | 3300010882 | Bacteria | 2470 |
| 43 | Ga0466715_128411 | 3300042616 | Bacteria | 7057 |
| 44 | Ga0466715_539374 | 3300042616 | Bacteria | 9720 |
| 45 | Ga0466726_237862 | 3300042619 | Bacteria | 1412 |
| 46 | IMNBL1DRAFT_c0181821 | 3300000062 | Bacteria | 531 |
| 47 | JGI24702J35022_10245411 | 3300002462 | Bacteria | 1040 |
| 48 | Ga0466704_195856 | 3300042643 | Bacteria | 7418 |
| 49 | Ga0466707_298597 | 3300042601 | Bacteria | 2777 |
| 50 | Ga0466697_025392 | 3300042611 | Bacteria | 2004 |
| 51 | Ga0466705_034473 | 3300042612 | Bacteria | 5010 |
| 52 | Ga0466705_197946 | 3300042612 | Unclassified | 1358 |
| 53 | Ga0466695_221757 | 3300042595 | Bacteria | 1711 |
| 54 | Ga0123356_11081986 | 3300010049 | Bacteria | 970 |
| 55 | Ga0466710_034335 | 3300042613 | Bacteria | 1265 |
| 56 | Ga0466729_195805 | 3300042621 | Bacteria | 1305 |
| 57 | Ga0466729_315400 | 3300042621 | Bacteria | 1273 |
| 58 | Ga0466731_339013 | 3300042622 | Bacteria | 4721 |
| 59 | Ga0466735_215598 | 3300042624 | Bacteria | 1193 |
| 60 | Ga0466706_088395 | 3300042599 | Bacteria | 1670 |
| 61 | Ga0466719_543848 | 3300042606 | Bacteria | 6085 |
| 62 | Ga0466722_018605 | 3300042609 | Bacteria | 4849 |
| 63 | Ga0265387_1082639 | 3300024582 | Bacteria | 640 |
| 64 | Ga0466696_241979 | 3300042596 | Bacteria | 2717 |
| 65 | Ga0123357_10251517 | 3300009784 | Bacteria | 1890 |
| 66 | Ga0123356_12093677 | 3300010049 | Bacteria | 706 |
| 67 | Ga0123353_10129797 | 3300010167 | Bacteria | 4046 |
| 68 | Ga0123353_10233382 | 3300010167 | Bacteria | 2866 |
| 69 | Ga0123353_10786437 | 3300010167 | Bacteria | 1317 |
| 70 | Ga0123353_11782004 | 3300010167 | Bacteria | 766 |
| 71 | Ga0123354_10057907 | 3300010882 | Bacteria | 5766 |
| 72 | 2227551831 | 2225789004 | Bacteria | 578 |
| 73 | IMNBL1DRAFT_c0008508 | 3300000062 | Bacteria | 5214 |
| 74 | JGI24696J40584_12847999 | 3300002834 | Bacteria | 973 |
| 75 | Ga0072941_1358227 | 3300005201 | Bacteria | 2817 |
| 76 | Ga0466735_074457 | 3300042624 | Unclassified | 4404 |
| 77 | Ga0466735_161436 | 3300042624 | Bacteria | 1147 |
| 78 | Ga0466697_019874 | 3300042611 | Bacteria | 1896 |
| 79 | Ga0466691_180708 | 3300042593 | Bacteria | 1516 |
| 80 | Ga0123357_10354349 | 3300009784 | Bacteria | 1399 |
| 81 | Ga0123354_10535587 | 3300010882 | Bacteria | 892 |
| 82 | Ga0466710_046673 | 3300042613 | Bacteria | 1205 |
| 83 | Ga0466715_595889 | 3300042616 | Bacteria | 6125 |
| 84 | 2227124154 | 2225789004 | Bacteria | 1687 |
| 85 | Ga0466709_277595 | 3300042648 | Bacteria | 221236 |
| 86 | Ga0466724_53134 | 3300042649 | Bacteria | 1290 |
| 87 | Ga0466701_051204 | 3300042598 | Bacteria | 2533 |
| 88 | Ga0466706_035215 | 3300042599 | Bacteria | 6646 |
| 89 | Ga0466700_061412 | 3300042600 | Bacteria | 1436 |
| 90 | Ga0466719_316953 | 3300042606 | Bacteria | 4538 |
| 91 | Ga0466705_267781 | 3300042612 | Bacteria | 2138 |
| 92 | Ga0466733_092993 | 3300042659 | Bacteria | 1090 |
| 93 | Ga0466699_290887 | 3300042597 | Bacteria | 1507 |
| 94 | Ga0123356_10463196 | 3300010049 | Bacteria | 1418 |
| 95 | Ga0123356_11948947 | 3300010049 | Bacteria | 732 |
| 96 | Ga0123353_10556015 | 3300010167 | Bacteria | 1653 |
| 97 | Ga0123354_10447009 | 3300010882 | Bacteria | 1050 |
| 98 | Ga0466728_096633 | 3300042620 | Bacteria | 14800 |
| 99 | 2227473897 | 2225789004 | Bacteria | 901 |
| 100 | JGI24702J35022_10528829 | 3300002462 | Unclassified | 725 |
| 101 | Ga0466735_016795 | 3300042624 | Bacteria | 2349 |
| 102 | Ga0466709_134742 | 3300042648 | Bacteria | 3877 |
| 103 | Ga0466706_062172 | 3300042599 | Unclassified | 4782 |
| 104 | Ga0466706_103666 | 3300042599 | Bacteria | 1626 |
| 105 | Ga0466706_218722 | 3300042599 | Bacteria | 2925 |
| 106 | Ga0466707_160106 | 3300042601 | Bacteria | 3983 |
| 107 | Ga0466714_007719 | 3300042603 | Bacteria | 1454 |
| 108 | Ga0466722_014096 | 3300042609 | Bacteria | 2610 |
| 109 | Ga0466692_009548 | 3300042591 | Bacteria | 44813 |
| 110 | Ga0466694_274968 | 3300042594 | Unclassified | 4629 |
| 111 | Ga0466694_341834 | 3300042594 | Bacteria | 3127 |
| 112 | Ga0466695_265890 | 3300042595 | Bacteria | 1754 |
| 113 | Ga0466695_319289 | 3300042595 | Bacteria | 2296 |
| 114 | Ga0123353_11120487 | 3300010167 | Bacteria | 1042 |
| 115 | Ga0123354_10205363 | 3300010882 | Bacteria | 2150 |
| 116 | Ga0466711_009504 | 3300042615 | Bacteria | 13457 |
| 117 | Ga0466711_096911 | 3300042615 | Bacteria | 2314 |
| 118 | Ga0466704_042430 | 3300042643 | Bacteria | 2633 |
| 119 | Ga0466727_120472 | 3300042655 | Bacteria | 3237 |
| 120 | Ga0466706_031584 | 3300042599 | Unclassified | 1150 |
| 121 | Ga0466706_107125 | 3300042599 | Bacteria | 7464 |
| 122 | Ga0466706_163906 | 3300042599 | Bacteria | 105365 |
| 123 | Ga0466706_188206 | 3300042599 | Bacteria | 2669 |
| 124 | Ga0466716_000365 | 3300042605 | Bacteria | 17966 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13657 | Couple_hipA | HipA N-terminal domain | 22 | 120 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.