Protein Family IF03479
Metagenome
Metatranscriptome
Isolate
180
Members
85
Samples
155
Scaffolds
98.72
Avg Length
Representative Sequence
- ID
- 3300010882|Ga0123354_10025356|Ga0123354_100253565
- Length
- 112 aa
- Sequence
- MFYSKIRNPANMNTSFEILLKPILTEKLTAQEEHLNRYGFKVDRTANKIQIKKAIEEMYGVTVEAVNTMRYAGKNKSRFTKAGVIAGRGNHFKKAMITLKKGDKIDFYSNI*
Sample Types
Isolate
13.9%
Metagenome
84.4%
MAG
0.0%
Metatranscriptome
1.7%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
36.6%
Kalotermitidae
14.6%
Unclassified
12.2%
Blattidae
11.0%
Rhinotermitidae
6.1%
Termopsidae
4.9%
Hydrophilidae
2.4%
Passalidae
2.4%
Hodotermitidae
1.2%
Armadillidiidae
1.2%
Kiwaidae
1.2%
Noctuidae
1.2%
Nephropidae
1.2%
Drosophilidae
1.2%
Harpacticidae
1.2%
Apidae
1.2%
Taxonomy
Archaea
0
Bacteria
172
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 2 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 3 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 4 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 5 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 6 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 7 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 8 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 9 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 10 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 11 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 14 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 15 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 16 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 17 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 18 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 19 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 20 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 21 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 22 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 23 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 24 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 25 | 3300013007 | Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts | Metagenome | Kiwaidae |
| 26 | 2820727601 | Unclassified Cloacimonetes Nt197P3bin46 | Isolate | Unclassified |
| 27 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 28 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 29 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 30 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 31 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 32 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 33 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 34 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 35 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 36 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 37 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 38 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 39 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 40 | 2820044805 | Unclassified Proteobacteria Th196P4bin15 | Isolate | Unclassified |
| 41 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 42 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 43 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 44 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 45 | 2983866074 | Paenibacillus polymyxa A18 | Isolate | Unclassified |
| 46 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 47 | 3300021245 | Termite gut microbial communities from nest from French Guiana - 11-4 mRNA SA | Metatranscriptome | Termitidae |
| 48 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 49 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 50 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 51 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 52 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 53 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 54 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 55 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 56 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 57 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 58 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 59 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 60 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 61 | 3300021221 | Termite gut microbial communities from nest - French Guiana - 18a-5 mRNA SA | Metatranscriptome | Termitidae |
| 62 | 2551306396 | Paenibacillus sp. ICGEB2008 | Isolate | Noctuidae |
| 63 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 64 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 65 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 66 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 67 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 68 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 69 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 70 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 71 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 72 | 2021593000 | Sample 264 | Metagenome | Harpacticidae |
| 73 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 74 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 75 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 76 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 77 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 78 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 79 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 80 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 81 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 82 | 2971438493 | Paenibacillus apiarius NRRL B-23460 | Isolate | Apidae |
| 83 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 84 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 85 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466709_170238 | 3300042648 | Bacteria | 55916 |
| 2 | Ga0123357_10049693 | 3300009784 | Bacteria | 5680 |
| 3 | Ga0123353_10001965 | 3300010167 | Bacteria | 25350 |
| 4 | Ga0123353_10402705 | 3300010167 | Bacteria | 2036 |
| 5 | Ga0466657_330370 | 3300042582 | Bacteria | 1117 |
| 6 | Ga0466690_095939 | 3300042590 | Bacteria | 5717 |
| 7 | Ga0466690_287618 | 3300042590 | Bacteria | 16965 |
| 8 | Ga0466694_037794 | 3300042594 | Bacteria | 1123 |
| 9 | Ga0466710_082075 | 3300042613 | Bacteria | 1736 |
| 10 | Ga0466715_045203 | 3300042616 | Bacteria | 21834 |
| 11 | 2227484956 | 2225789004 | Bacteria | 824 |
| 12 | JGI24705J35276_11366159 | 3300002504 | Bacteria | 518 |
| 13 | Ga0105005_1329385 | 3300007505 | Bacteria | 580 |
| 14 | Ga0466697_256611 | 3300042611 | Bacteria | 1086 |
| 15 | Ga0466727_349423 | 3300042655 | Bacteria | 30219 |
| 16 | Ga0466733_052918 | 3300042659 | Bacteria | 1967 |
| 17 | Ga0466733_204953 | 3300042659 | Bacteria | 3034 |
| 18 | Ga0466734_150090 | 3300042623 | Bacteria | 1234 |
| 19 | Ga0466735_232692 | 3300042624 | Bacteria | 20733 |
| 20 | Ga0466703_269331 | 3300042636 | Bacteria | 1526 |
| 21 | Ga0466725_255972 | 3300042654 | Bacteria | 39464 |
| 22 | Ga0466727_012114 | 3300042655 | Bacteria | 4624 |
| 23 | Ga0123356_10086245 | 3300010049 | Bacteria | 2980 |
| 24 | Ga0123356_10305778 | 3300010049 | Bacteria | 1697 |
| 25 | Ga0123356_12573574 | 3300010049 | Bacteria | 637 |
| 26 | Ga0123356_12988717 | 3300010049 | Bacteria | 590 |
| 27 | Ga0123353_10152434 | 3300010167 | Bacteria | 3688 |
| 28 | Ga0123353_11012807 | 3300010167 | Unclassified | 1114 |
| 29 | Ga0466700_021305 | 3300042600 | Bacteria | 30578 |
| 30 | Ga0466717_255735 | 3300042604 | Bacteria | 4005 |
| 31 | Ga0466710_347434 | 3300042613 | Bacteria | 1731 |
| 32 | Ga0466723_175652 | 3300042618 | Bacteria | 41824 |
| 33 | Ga0466726_142630 | 3300042619 | Bacteria | 1440 |
| 34 | IMNBL1DRAFT_c0053481 | 3300000062 | Bacteria | 1258 |
| 35 | Ga0072941_1073474 | 3300005201 | Bacteria | 1324 |
| 36 | Ga0466732_019305 | 3300042656 | Unclassified | 1428 |
| 37 | Ga0466708_014146 | 3300042652 | Bacteria | 33245 |
| 38 | Ga0123356_10042349 | 3300010049 | Bacteria | 4242 |
| 39 | Ga0123356_10786814 | 3300010049 | Unclassified | 1122 |
| 40 | Ga0223689_102448 | 3300021221 | Bacteria | 669 |
| 41 | Ga0223683_1084349 | 3300021245 | Bacteria | 522 |
| 42 | Ga0466657_203302 | 3300042582 | Bacteria | 2737 |
| 43 | Ga0466695_019243 | 3300042595 | Bacteria | 4125 |
| 44 | Ga0466696_398980 | 3300042596 | Bacteria | 15504 |
| 45 | Ga0466706_064416 | 3300042599 | Bacteria | 22081 |
| 46 | Ga0466713_017147 | 3300042602 | Bacteria | 4646 |
| 47 | Ga0466710_416897 | 3300042613 | Bacteria | 23309 |
| 48 | Ga0466711_062266 | 3300042615 | Bacteria | 2461 |
| 49 | IMNBL1DRAFT_c0002428 | 3300000062 | Bacteria | 12971 |
| 50 | IMNBL1DRAFT_c0079345 | 3300000062 | Bacteria | 924 |
| 51 | Ga0072941_1514243 | 3300005201 | Bacteria | 565 |
| 52 | Ga0466703_019525 | 3300042636 | Bacteria | 29012 |
| 53 | Ga0466704_442514 | 3300042643 | Bacteria | 75471 |
| 54 | Ga0123356_10070678 | 3300010049 | Bacteria | 3274 |
| 55 | Ga0123356_11317278 | 3300010049 | Unclassified | 885 |
| 56 | Ga0123356_13578338 | 3300010049 | Unclassified | 538 |
| 57 | Ga0123353_10106017 | 3300010167 | Bacteria | 4529 |
| 58 | Ga0123353_10186932 | 3300010167 | Bacteria | 3275 |
| 59 | Ga0233288_1020593 | 3300022232 | Bacteria | 1403 |
| 60 | Ga0466701_034352 | 3300042598 | Bacteria | 2625 |
| 61 | Ga0466706_191825 | 3300042599 | Bacteria | 26014 |
| 62 | Ga0466707_152952 | 3300042601 | Bacteria | 15357 |
| 63 | Ga0466713_137400 | 3300042602 | Bacteria | 1552 |
| 64 | Ga0466722_055729 | 3300042609 | Bacteria | 3414 |
| 65 | Ga0466712_180312 | 3300042614 | Bacteria | 2900 |
| 66 | Ga0466726_284088 | 3300042619 | Bacteria | 8137 |
| 67 | Ga0466729_193843 | 3300042621 | Bacteria | 2391 |
| 68 | IMNBL1DRAFT_c0020686 | 3300000062 | Bacteria | 2654 |
| 69 | JGI24705J35276_12234796 | 3300002504 | Bacteria | 5858 |
| 70 | Ga0466697_105486 | 3300042611 | Bacteria | 1506 |
| 71 | Ga0466732_339081 | 3300042656 | Bacteria | 1415 |
| 72 | Ga0466733_174455 | 3300042659 | Bacteria | 4998 |
| 73 | Ga0466730_020607 | 3300042625 | Bacteria | 3112 |
| 74 | Ga0466702_060779 | 3300042635 | Bacteria | 1415 |
| 75 | Ga0123356_10018638 | 3300010049 | Bacteria | 6586 |
| 76 | Ga0123356_10319132 | 3300010049 | Bacteria | 1666 |
| 77 | Ga0123354_10025356 | 3300010882 | Bacteria | 9348 |
| 78 | Ga0466701_014159 | 3300042598 | Bacteria | 1343 |
| 79 | Ga0466706_124077 | 3300042599 | Bacteria | 1141 |
| 80 | Ga0466700_233886 | 3300042600 | Bacteria | 5710 |
| 81 | Ga0466707_374739 | 3300042601 | Bacteria | 28797 |
| 82 | Ga0466716_065737 | 3300042605 | Bacteria | 4990 |
| 83 | Ga0466716_532094 | 3300042605 | Bacteria | 21649 |
| 84 | Ga0466710_453259 | 3300042613 | Bacteria | 4177 |
| 85 | Ga0466715_586714 | 3300042616 | Bacteria | 57830 |
| 86 | Ga0466729_117874 | 3300042621 | Bacteria | 2916 |
| 87 | JGI24695J34938_10112447 | 3300002450 | Unclassified | 1109 |
| 88 | JGI24702J35022_10005043 | 3300002462 | Bacteria | 7778 |
| 89 | JGI24702J35022_10320345 | 3300002462 | Bacteria | 919 |
| 90 | Ga0466697_093502 | 3300042611 | Bacteria | 1250 |
| 91 | Ga0466705_092258 | 3300042612 | Bacteria | 6924 |
| 92 | Ga0466703_249699 | 3300042636 | Bacteria | 47455 |
| 93 | Ga0466704_311970 | 3300042643 | Bacteria | 2079 |
| 94 | Ga0466725_361915 | 3300042654 | Bacteria | 1100 |
| 95 | Ga0466727_117581 | 3300042655 | Bacteria | 2355 |
| 96 | Ga0123355_10439773 | 3300009826 | Bacteria | 1652 |
| 97 | Ga0123356_10360153 | 3300010049 | Bacteria | 1581 |
| 98 | Ga0123356_10655471 | 3300010049 | Bacteria | 1217 |
| 99 | Ga0123356_11068384 | 3300010049 | Bacteria | 976 |
| 100 | Ga0123356_12528326 | 3300010049 | Unclassified | 643 |
| 101 | Ga0160456_112972 | 3300012820 | Bacteria | 824 |
| 102 | Ga0466707_245265 | 3300042601 | Bacteria | 1827 |
| 103 | Ga0466717_251818 | 3300042604 | Bacteria | 1157 |
| 104 | Ga0466721_228876 | 3300042608 | Bacteria | 1046 |
| 105 | Ga0466711_080899 | 3300042615 | Bacteria | 15234 |
| 106 | Ga0466715_533905 | 3300042616 | Bacteria | 9746 |
| 107 | Ga0466723_373256 | 3300042618 | Bacteria | 33738 |
| 108 | Ga0466726_471260 | 3300042619 | Bacteria | 1798 |
| 109 | TM1208_contig62774 | 2021593000 | Bacteria | 556 |
| 110 | 2227527393 | 2225789004 | Bacteria | 16791 |
| 111 | IMNBL1DRAFT_c0000687 | 3300000062 | Bacteria | 27159 |
| 112 | JGI24702J35022_10006433 | 3300002462 | Bacteria | 6791 |
| 113 | JGI24702J35022_10231668 | 3300002462 | Bacteria | 1068 |
| 114 | JGI24705J35276_12139085 | 3300002504 | Bacteria | 1133 |
| 115 | Ga0072941_1370518 | 3300005201 | Bacteria | 1785 |
| 116 | Ga0466733_020611 | 3300042659 | Bacteria | 2555 |
| 117 | Ga0466733_120712 | 3300042659 | Bacteria | 3449 |
| 118 | Ga0466733_200869 | 3300042659 | Bacteria | 1898 |
| 119 | Ga0466708_169565 | 3300042652 | Bacteria | 34312 |
| 120 | Ga0123356_10054982 | 3300010049 | Bacteria | 3707 |
| 121 | Ga0123356_11007862 | 3300010049 | Bacteria | 1003 |
| 122 | Ga0123356_11231259 | 3300010049 | Unclassified | 914 |
| 123 | Ga0123353_13088988 | 3300010167 | Bacteria | 537 |
| 124 | Ga0466657_385166 | 3300042582 | Bacteria | 1398 |
| 125 | Ga0466692_149579 | 3300042591 | Bacteria | 83669 |
| 126 | Ga0466701_074079 | 3300042598 | Bacteria | 1177 |
| 127 | Ga0466706_142094 | 3300042599 | Bacteria | 1186 |
| 128 | Ga0466713_072740 | 3300042602 | Bacteria | 29878 |
| 129 | Ga0466714_110110 | 3300042603 | Bacteria | 3022 |
| 130 | Ga0466719_385682 | 3300042606 | Bacteria | 3334 |
| 131 | 2227325260 | 2225789004 | Bacteria | 1181 |
| 132 | 2227473157 | 2225789004 | Bacteria | 907 |
| 133 | IMNBL1DRAFT_c0144727 | 3300000062 | Bacteria | 613 |
| 134 | JGI24702J35022_10004749 | 3300002462 | Bacteria | 8038 |
| 135 | JGI24696J40584_12877013 | 3300002834 | Bacteria | 1068 |
| 136 | Ga0466734_173702 | 3300042623 | Bacteria | 1787 |
| 137 | Ga0466735_216908 | 3300042624 | Bacteria | 3045 |
| 138 | Ga0466703_369160 | 3300042636 | Bacteria | 28465 |
| 139 | Ga0466708_143755 | 3300042652 | Bacteria | 8647 |
| 140 | Ga0123357_10005900 | 3300009784 | Bacteria | 14780 |
| 141 | Ga0157631_112806 | 3300013007 | Bacteria | 3277 |
| 142 | Ga0264413_148151 | 3300024493 | Bacteria | 2089 |
| 143 | Ga0466656_102353 | 3300042550 | Bacteria | 1465 |
| 144 | Ga0466690_136026 | 3300042590 | Bacteria | 11620 |
| 145 | Ga0466692_159524 | 3300042591 | Bacteria | 46807 |
| 146 | Ga0466706_086447 | 3300042599 | Bacteria | 4039 |
| 147 | Ga0466707_375112 | 3300042601 | Bacteria | 17480 |
| 148 | Ga0466713_113019 | 3300042602 | Bacteria | 16771 |
| 149 | Ga0466717_113039 | 3300042604 | Bacteria | 1060 |
| 150 | Ga0466719_292822 | 3300042606 | Bacteria | 42754 |
| 151 | Ga0466722_267306 | 3300042609 | Bacteria | 1656 |
| 152 | Ga0466723_184116 | 3300042618 | Bacteria | 30069 |
| 153 | IMNBL1DRAFT_c0000119 | 3300000062 | Bacteria | 71190 |
| 154 | Ga0068302_10187715 | 3300005071 | Bacteria | 1590 |
| 155 | Ga0068305_10010112 | 3300005083 | Bacteria | 17726 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00276 | Ribosomal_L23 | Ribosomal protein L23 | 18 | 107 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.