Protein Family IF03469
Metagenome
Metatranscriptome
Isolate
392
Members
158
Samples
301
Scaffolds
179.64
Avg Length
Representative Sequence
- ID
- 3300010882|Ga0123354_10012254|Ga0123354_1001225418
- Length
- 212 aa
- Sequence
- LLASESRFKALVYELFQALGSRFQHLVRRQTMSRIGKLPIPVPAGVDVKIDEGNMLTIKGPKGTLSRKLSADMHIAMDNGVLTVERPNDLKKFKSLHGLTRTLINNMVDGVTKGFSKTLEIAGVGYRAAKSGNELTLTLGYSHPIKMVDPDGITTTVDGTNKITVSGIDKEKVGQHAANIRSKRAIEPYNAKGIKYSNEKVRRKVGKTGKK*
Sample Types
Isolate
23.2%
Metagenome
76.0%
MAG
0.0%
Metatranscriptome
0.8%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
39.2%
Termitidae
19.6%
Kalotermitidae
9.8%
Blattidae
9.2%
Anthocoridae
6.5%
Tenebrionidae
2.6%
Rhinotermitidae
2.0%
Dytiscidae
2.0%
Culicidae
1.3%
Cambaridae
1.3%
Armadillidiidae
1.3%
Passalidae
1.3%
Hodotermitidae
0.7%
Scarabaeidae
0.7%
Cerambycidae
0.7%
Chironomidae
0.7%
Termopsidae
0.7%
Formicidae
0.7%
Taxonomy
Archaea
0
Bacteria
364
Eukaryota
0
Viruses
0
Unclassified
28
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820944107 | Unclassified Actinobacteria Cu122P5bin14 | Isolate | Unclassified |
| 2 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 3 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 4 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 5 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 6 | 2820275298 | Unclassified Firmicutes Th196P3bin17 | Isolate | Unclassified |
| 7 | 2820435670 | Unclassified Firmicutes Lab288P3bin217 | Isolate | Unclassified |
| 8 | 2820457604 | Unclassified Firmicutes Lab288P3bin15 | Isolate | Unclassified |
| 9 | 2820602899 | Unclassified Firmicutes Emb289P1bin51 | Isolate | Unclassified |
| 10 | 2820709481 | Unclassified Firmicutes Co191P1bin30 | Isolate | Unclassified |
| 11 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 12 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 13 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 14 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 15 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 16 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 17 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 18 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 19 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 20 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 21 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 22 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 23 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 24 | 2847305884 | Microbacterium protaetiae DFW100M-13 | Isolate | Scarabaeidae |
| 25 | 2894981435 | Leucobacter sp. OLDS2 | Isolate | Anthocoridae |
| 26 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 27 | 2084038013 | Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae | Metagenome | Cerambycidae |
| 28 | 2820371985 | Unclassified Firmicutes Nt197P3bin100 | Isolate | Unclassified |
| 29 | 2820469612 | Unclassified Firmicutes Lab288P1bin92 | Isolate | Unclassified |
| 30 | 2820499546 | Unclassified Firmicutes Lab288P1bin54 | Isolate | Unclassified |
| 31 | 2820522177 | Unclassified Firmicutes Lab288P1bin22 | Isolate | Unclassified |
| 32 | 2820541116 | Unclassified Firmicutes Lab288P1bin109 | Isolate | Unclassified |
| 33 | 2820644600 | Unclassified Firmicutes Cu122P5bin39 | Isolate | Unclassified |
| 34 | 2820654856 | Unclassified Firmicutes Cu122P1bin2 | Isolate | Unclassified |
| 35 | 2820671341 | Unclassified Firmicutes Co191P3bin20 | Isolate | Unclassified |
| 36 | 2820702360 | Unclassified Firmicutes Co191P1bin4 | Isolate | Unclassified |
| 37 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 38 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 39 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 40 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 41 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 42 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 43 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 44 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 45 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 46 | 2820807258 | Unclassified Actinobacteria Nt197P3bin90 | Isolate | Unclassified |
| 47 | 2820889385 | Unclassified Actinobacteria Lab288P1bin133 | Isolate | Unclassified |
| 48 | 2894944011 | Leucobacter sp. OLAS13 | Isolate | Anthocoridae |
| 49 | 2915166107 | Leucobacter sp. cx-87 | Isolate | Cambaridae |
| 50 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 51 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 52 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 53 | 2820385248 | Unclassified Firmicutes Nt197P1bin19 | Isolate | Unclassified |
| 54 | 2820487239 | Unclassified Firmicutes Lab288P1bin71 | Isolate | Unclassified |
| 55 | 2820492969 | Unclassified Firmicutes Lab288P1bin6 | Isolate | Unclassified |
| 56 | 2820539610 | Unclassified Firmicutes Lab288P1bin136 | Isolate | Unclassified |
| 57 | 2820673891 | Unclassified Firmicutes Co191P3bin18 | Isolate | Unclassified |
| 58 | 2820676843 | Unclassified Firmicutes Co191P3bin17 | Isolate | Unclassified |
| 59 | 2820713307 | Unclassified Firmicutes Co191P1bin2 | Isolate | Unclassified |
| 60 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 61 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 62 | 651324002 | Acetonema longum APO-1, DSM 6540 | Isolate | Kalotermitidae |
| 63 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 64 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 65 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 66 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 67 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 68 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 69 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 70 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 71 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 72 | 2820934415 | Unclassified Actinobacteria Emb289P1bin68 | Isolate | Unclassified |
| 73 | 2894926108 | Leucobacter sp. OLES1 | Isolate | Anthocoridae |
| 74 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 75 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 76 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 77 | 2820418027 | Unclassified Firmicutes Lab288P3bin85 | Isolate | Unclassified |
| 78 | 2820630457 | Unclassified Firmicutes Emb289P1bin119 | Isolate | Unclassified |
| 79 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 80 | 8030347546 | Propionimicrobium sp. PCR01-08-3 | Isolate | Tenebrionidae |
| 81 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 82 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 83 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 84 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 85 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 86 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 87 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 88 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 89 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
| 90 | 2894932631 | Leucobacter sp. OAMLP11 | Isolate | Anthocoridae |
| 91 | 2894966443 | Leucobacter sp. OLCALW19 | Isolate | Anthocoridae |
| 92 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 93 | 2524023214 | Leucobacter chironomi DSM 19883 | Isolate | Chironomidae |
| 94 | 2820238527 | Unclassified Firmicutes Th196P3bin90 | Isolate | Unclassified |
| 95 | 2820316744 | Unclassified Firmicutes Nt197P3bin99 | Isolate | Unclassified |
| 96 | 2820481688 | Unclassified Firmicutes Lab288P1bin76 | Isolate | Unclassified |
| 97 | 2820490862 | Unclassified Firmicutes Lab288P1bin64 | Isolate | Unclassified |
| 98 | 2820537337 | Unclassified Firmicutes Lab288P1bin137 | Isolate | Unclassified |
| 99 | 2820623020 | Unclassified Firmicutes Emb289P1bin126 | Isolate | Unclassified |
| 100 | 2820685979 | Unclassified Firmicutes Co191P1bin81 | Isolate | Unclassified |
| 101 | 2820696217 | Unclassified Firmicutes Co191P1bin66 | Isolate | Unclassified |
| 102 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 103 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 104 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 105 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 106 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 107 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 108 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 109 | 2820863028 | Unclassified Actinobacteria Lab288P3bin164 | Isolate | Unclassified |
| 110 | 2820899690 | Unclassified Actinobacteria Emb289P4bin9 | Isolate | Unclassified |
| 111 | 2873617540 | Leucobacter insecticola HDW9B | Isolate | Dytiscidae |
| 112 | 2894900265 | Leucobacter sp. OLTLW20 | Isolate | Anthocoridae |
| 113 | 2894929448 | Leucobacter sp. OAMSW11 | Isolate | Anthocoridae |
| 114 | 2915168811 | Leucobacter sp. cx-169 | Isolate | Cambaridae |
| 115 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 116 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 117 | 2820375548 | Unclassified Firmicutes Nt197P1bin8 | Isolate | Unclassified |
| 118 | 2820408893 | Unclassified Firmicutes Lab288P4bin80 | Isolate | Unclassified |
| 119 | 2820094617 | Unclassified Proteobacteria Lab288P3bin216 | Isolate | Unclassified |
| 120 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 121 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 122 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 123 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 124 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 125 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 126 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 127 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 128 | 2873614151 | Leucobacter viscericola HDW9C | Isolate | Dytiscidae |
| 129 | 2894897082 | Leucobacter sp. OLCS4 | Isolate | Anthocoridae |
| 130 | 2894974975 | Leucobacter sp. OLIS6 | Isolate | Anthocoridae |
| 131 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 132 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 133 | 2820378768 | Unclassified Firmicutes Nt197P1bin7 | Isolate | Unclassified |
| 134 | 2820382897 | Unclassified Firmicutes Nt197P1bin3 | Isolate | Unclassified |
| 135 | 2820513949 | Unclassified Firmicutes Lab288P1bin39 | Isolate | Unclassified |
| 136 | 2820535361 | Unclassified Firmicutes Lab288P1bin14 | Isolate | Unclassified |
| 137 | 2820617402 | Unclassified Firmicutes Emb289P1bin131 | Isolate | Unclassified |
| 138 | 2820627938 | Unclassified Firmicutes Emb289P1bin122 | Isolate | Unclassified |
| 139 | 2820693137 | Unclassified Firmicutes Co191P1bin70 | Isolate | Unclassified |
| 140 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 141 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 142 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 143 | 2820829137 | Unclassified Actinobacteria Nc150P5bin2 | Isolate | Unclassified |
| 144 | 2820911766 | Unclassified Actinobacteria Emb289P3bin96 | Isolate | Unclassified |
| 145 | 2873620646 | Leucobacter coleopterorum HDW9A | Isolate | Dytiscidae |
| 146 | 2894935787 | Leucobacter sp. OLJS4 | Isolate | Anthocoridae |
| 147 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 148 | 2816332114 | Microbacterium saperdae DSM 20169 | Isolate | Unclassified |
| 149 | 2820309449 | Unclassified Firmicutes Th196P1bin10 | Isolate | Unclassified |
| 150 | 2820347164 | Unclassified Firmicutes Nt197P3bin58 | Isolate | Unclassified |
| 151 | 2820380671 | Unclassified Firmicutes Nt197P1bin4 | Isolate | Unclassified |
| 152 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 153 | 2820600392 | Unclassified Firmicutes Emb289P1bin52 | Isolate | Unclassified |
| 154 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 155 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 156 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 157 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 158 | 3300021231 | Termite gut microbial communities from nest - French Guiana - 10-1 mRNA SA | Metatranscriptome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_061344 | 3300042612 | Bacteria | 17468 |
| 2 | Ga0466705_244395 | 3300042612 | Bacteria | 7115 |
| 3 | Ga0562374_0162 | 3300057007 | Bacteria | 154514 |
| 4 | Ga0123357_10009986 | 3300009784 | Bacteria | 12028 |
| 5 | Ga0123355_10000168 | 3300009826 | Bacteria | 79476 |
| 6 | Ga0123355_10002703 | 3300009826 | Bacteria | 25128 |
| 7 | Ga0123355_10042480 | 3300009826 | Bacteria | 7400 |
| 8 | Ga0123355_10164231 | 3300009826 | Bacteria | 3337 |
| 9 | Ga0123355_10438575 | 3300009826 | Bacteria | 1655 |
| 10 | Ga0123355_10490543 | 3300009826 | Bacteria | 1522 |
| 11 | Ga0123355_10757471 | 3300009826 | Bacteria | 1096 |
| 12 | Ga0123355_10905183 | 3300009826 | Bacteria | 958 |
| 13 | Ga0123356_10000406 | 3300010049 | Bacteria | 48995 |
| 14 | Ga0123353_10123947 | 3300010167 | Bacteria | 4153 |
| 15 | Ga0123353_10142855 | 3300010167 | Unclassified | 3832 |
| 16 | Ga0123353_10316635 | 3300010167 | Bacteria | 2370 |
| 17 | Ga0123353_11357565 | 3300010167 | Unclassified | 918 |
| 18 | Ga0123354_10012254 | 3300010882 | Bacteria | 13287 |
| 19 | Ga0123354_10239766 | 3300010882 | Bacteria | 1869 |
| 20 | 2227465192 | 2225789004 | Unclassified | 5212 |
| 21 | JGI24695J34938_10195322 | 3300002450 | Unclassified | 842 |
| 22 | JGI24703J35330_11748269 | 3300002501 | Bacteria | 12890 |
| 23 | JGI24703J35330_11748512 | 3300002501 | Bacteria | 18286 |
| 24 | Ga0068305_10002308 | 3300005083 | Bacteria | 45236 |
| 25 | Ga0123357_10001723 | 3300009784 | Bacteria | 23593 |
| 26 | Ga0466706_103864 | 3300042599 | Bacteria | 13046 |
| 27 | Ga0466700_424753 | 3300042600 | Bacteria | 1684 |
| 28 | Ga0466707_238916 | 3300042601 | Bacteria | 2869 |
| 29 | Ga0466719_086513 | 3300042606 | Bacteria | 15067 |
| 30 | Ga0466719_203918 | 3300042606 | Bacteria | 15671 |
| 31 | Ga0466715_416878 | 3300042616 | Bacteria | 48123 |
| 32 | Ga0466709_323155 | 3300042648 | Bacteria | 19411 |
| 33 | Ga0466724_27243 | 3300042649 | Bacteria | 6777 |
| 34 | Ga0466725_438088 | 3300042654 | Bacteria | 2316 |
| 35 | Ga0160457_1002026 | 3300012858 | Bacteria | 4717 |
| 36 | Ga0233288_1002950 | 3300022232 | Bacteria | 1945 |
| 37 | Ga0415639_000644 | 3300038395 | Bacteria | 27607 |
| 38 | Ga0415639_040961 | 3300038395 | Bacteria | 2726 |
| 39 | Ga0466693_061563 | 3300042592 | Bacteria | 1153 |
| 40 | Ga0466691_068792 | 3300042593 | Bacteria | 18041 |
| 41 | Ga0466694_203013 | 3300042594 | Bacteria | 1183 |
| 42 | Ga0466696_088894 | 3300042596 | Bacteria | 1583 |
| 43 | Ga0123357_10183998 | 3300009784 | Bacteria | 2430 |
| 44 | Ga0123357_10286276 | 3300009784 | Bacteria | 1692 |
| 45 | Ga0123357_10353818 | 3300009784 | Bacteria | 1401 |
| 46 | Ga0123355_10000164 | 3300009826 | Bacteria | 81449 |
| 47 | Ga0123355_10000459 | 3300009826 | Bacteria | 53637 |
| 48 | Ga0123355_10000550 | 3300009826 | Bacteria | 50132 |
| 49 | Ga0123355_10001096 | 3300009826 | Bacteria | 37400 |
| 50 | Ga0123355_10003105 | 3300009826 | Bacteria | 23706 |
| 51 | Ga0123355_10046376 | 3300009826 | Bacteria | 7068 |
| 52 | Ga0123355_10062748 | 3300009826 | Bacteria | 5996 |
| 53 | Ga0123355_10176176 | 3300009826 | Bacteria | 3184 |
| 54 | Ga0123355_10270815 | 3300009826 | Bacteria | 2360 |
| 55 | Ga0123355_11272983 | 3300009826 | Unclassified | 741 |
| 56 | Ga0123356_10137916 | 3300010049 | Bacteria | 2402 |
| 57 | Ga0123356_11318668 | 3300010049 | Bacteria | 885 |
| 58 | Ga0123356_11777577 | 3300010049 | Bacteria | 766 |
| 59 | Ga0123353_10000688 | 3300010167 | Bacteria | 41343 |
| 60 | Ga0123353_10073386 | 3300010167 | Bacteria | 5499 |
| 61 | Ga0123354_10132915 | 3300010882 | Bacteria | 3132 |
| 62 | Ga0123354_10178056 | 3300010882 | Bacteria | 2440 |
| 63 | JGI24695J34938_10003848 | 3300002450 | Bacteria | 10185 |
| 64 | JGI24703J35330_11748514 | 3300002501 | Bacteria | 18343 |
| 65 | Ga0072940_1148542 | 3300005200 | Bacteria | 5134 |
| 66 | Ga0466706_066171 | 3300042599 | Bacteria | 2857 |
| 67 | Ga0466706_094432 | 3300042599 | Bacteria | 10061 |
| 68 | Ga0466700_426729 | 3300042600 | Bacteria | 1439 |
| 69 | Ga0466707_098926 | 3300042601 | Bacteria | 16720 |
| 70 | Ga0466713_016024 | 3300042602 | Bacteria | 5771 |
| 71 | Ga0466714_111479 | 3300042603 | Bacteria | 8086 |
| 72 | Ga0466721_139283 | 3300042608 | Bacteria | 240312 |
| 73 | Ga0466721_155290 | 3300042608 | Bacteria | 1524 |
| 74 | Ga0466715_583568 | 3300042616 | Bacteria | 2849 |
| 75 | Ga0466723_104883 | 3300042618 | Bacteria | 18998 |
| 76 | Ga0466729_077403 | 3300042621 | Bacteria | 1825 |
| 77 | Ga0466702_149568 | 3300042635 | Bacteria | 1170 |
| 78 | Ga0160441_101991 | 3300012825 | Bacteria | 4768 |
| 79 | Ga0160458_121692 | 3300012832 | Bacteria | 659 |
| 80 | Ga0160433_109159 | 3300012846 | Unclassified | 1305 |
| 81 | Ga0415639_011215 | 3300038395 | Bacteria | 3506 |
| 82 | Ga0415639_033820 | 3300038395 | Bacteria | 8317 |
| 83 | Ga0415639_059431 | 3300038395 | Bacteria | 1484 |
| 84 | Ga0415639_098037 | 3300038395 | Bacteria | 1824 |
| 85 | Ga0466690_184185 | 3300042590 | Bacteria | 17569 |
| 86 | Ga0466692_067952 | 3300042591 | Bacteria | 1722 |
| 87 | Ga0123357_10186465 | 3300009784 | Bacteria | 2405 |
| 88 | Ga0123355_10102229 | 3300009826 | Bacteria | 4508 |
| 89 | Ga0123355_10214115 | 3300009826 | Bacteria | 2785 |
| 90 | Ga0123355_10372185 | 3300009826 | Unclassified | 1870 |
| 91 | Ga0123355_10685496 | 3300009826 | Unclassified | 1182 |
| 92 | Ga0123355_10864329 | 3300009826 | Bacteria | 992 |
| 93 | Ga0123356_10004286 | 3300010049 | Bacteria | 14755 |
| 94 | Ga0123356_10007080 | 3300010049 | Bacteria | 11238 |
| 95 | Ga0123356_10121603 | 3300010049 | Bacteria | 2540 |
| 96 | Ga0123356_10659050 | 3300010049 | Bacteria | 1214 |
| 97 | Ga0123353_10482987 | 3300010167 | Bacteria | 1812 |
| 98 | Ga0123354_10192517 | 3300010882 | Bacteria | 2277 |
| 99 | IMNBL1DRAFT_c0041742 | 3300000062 | Bacteria | 1537 |
| 100 | JGI24698J34947_10071146 | 3300002449 | Bacteria | 1671 |
| 101 | JGI24703J35330_11748024 | 3300002501 | Unclassified | 9993 |
| 102 | JGI24703J35330_11748775 | 3300002501 | Bacteria | 33848 |
| 103 | JGI24705J35276_12076960 | 3300002504 | Bacteria | 965 |
| 104 | JGI24705J35276_12238395 | 3300002504 | Bacteria | 20949 |
| 105 | Ga0466706_126733 | 3300042599 | Bacteria | 4299 |
| 106 | Ga0466719_393574 | 3300042606 | Bacteria | 1499 |
| 107 | Ga0466715_075583 | 3300042616 | Bacteria | 81099 |
| 108 | Ga0466728_155355 | 3300042620 | Bacteria | 2584 |
| 109 | Ga0255809_1018313 | 3300022820 | Bacteria | 1364 |
| 110 | Ga0415639_047619 | 3300038395 | Bacteria | 1822 |
| 111 | Ga0415639_196800 | 3300038395 | Bacteria | 2325 |
| 112 | Ga0466692_014686 | 3300042591 | Bacteria | 11280 |
| 113 | Ga0466692_103556 | 3300042591 | Bacteria | 1077 |
| 114 | Ga0466693_198069 | 3300042592 | Bacteria | 4338 |
| 115 | Ga0466699_044569 | 3300042597 | Bacteria | 1782 |
| 116 | Ga0123357_10135418 | 3300009784 | Bacteria | 3049 |
| 117 | Ga0123355_10029089 | 3300009826 | Bacteria | 8939 |
| 118 | Ga0123355_10067585 | 3300009826 | Bacteria | 5750 |
| 119 | Ga0123355_10104004 | 3300009826 | Bacteria | 4461 |
| 120 | Ga0123355_10746346 | 3300009826 | Bacteria | 1108 |
| 121 | Ga0123356_10438664 | 3300010049 | Bacteria | 1452 |
| 122 | Ga0123353_10021067 | 3300010167 | Bacteria | 9769 |
| 123 | Ga0123353_10153004 | 3300010167 | Bacteria | 3681 |
| 124 | Ga0123353_10884600 | 3300010167 | Unclassified | 1219 |
| 125 | JGI24695J34938_10000403 | 3300002450 | Bacteria | 42148 |
| 126 | JGI24695J34938_10019246 | 3300002450 | Bacteria | 3390 |
| 127 | JGI24702J35022_10016005 | 3300002462 | Bacteria | 4118 |
| 128 | JGI24705J35276_12238288 | 3300002504 | Bacteria | 18560 |
| 129 | Ga0466700_314307 | 3300042600 | Bacteria | 2755 |
| 130 | Ga0466705_475066 | 3300042612 | Bacteria | 3002 |
| 131 | Ga0466715_162043 | 3300042616 | Bacteria | 36555 |
| 132 | Ga0466723_034529 | 3300042618 | Bacteria | 4842 |
| 133 | Ga0466726_324507 | 3300042619 | Bacteria | 16558 |
| 134 | Ga0466703_124494 | 3300042636 | Bacteria | 7732 |
| 135 | Ga0466705_087864 | 3300042612 | Bacteria | 1573 |
| 136 | Ga0562379_0066 | 3300056790 | Bacteria | 440869 |
| 137 | Ga0123357_10535211 | 3300009784 | Bacteria | 946 |
| 138 | Ga0123355_10010920 | 3300009826 | Bacteria | 13973 |
| 139 | Ga0123355_10034985 | 3300009826 | Bacteria | 8165 |
| 140 | Ga0123355_10076902 | 3300009826 | Unclassified | 5336 |
| 141 | Ga0123355_10138528 | 3300009826 | Bacteria | 3732 |
| 142 | Ga0123355_10254859 | 3300009826 | Bacteria | 2464 |
| 143 | Ga0123355_10337212 | 3300009826 | Bacteria | 2013 |
| 144 | Ga0123355_10439593 | 3300009826 | Bacteria | 1652 |
| 145 | Ga0123356_10072787 | 3300010049 | Bacteria | 3230 |
| 146 | Ga0123356_10170057 | 3300010049 | Bacteria | 2189 |
| 147 | Ga0123356_10908278 | 3300010049 | Bacteria | 1052 |
| 148 | Ga0123356_11260122 | 3300010049 | Bacteria | 904 |
| 149 | Ga0123356_12233730 | 3300010049 | Bacteria | 684 |
| 150 | Ga0123353_10012572 | 3300010167 | Bacteria | 12051 |
| 151 | Ga0123353_10020258 | 3300010167 | Bacteria | 9926 |
| 152 | Ga0123353_10915450 | 3300010167 | Bacteria | 1192 |
| 153 | Ga0123354_10026362 | 3300010882 | Bacteria | 9168 |
| 154 | 2227322174 | 2225789004 | Bacteria | 1186 |
| 155 | IMNBL1DRAFT_c0003268 | 3300000062 | Bacteria | 10563 |
| 156 | JGI24703J35330_11196848 | 3300002501 | Bacteria | 759 |
| 157 | JGI24705J35276_12219479 | 3300002504 | Bacteria | 2207 |
| 158 | Ga0466706_040771 | 3300042599 | Bacteria | 18519 |
| 159 | Ga0466706_161420 | 3300042599 | Bacteria | 8833 |
| 160 | Ga0466707_403509 | 3300042601 | Bacteria | 3464 |
| 161 | Ga0466714_012747 | 3300042603 | Bacteria | 29171 |
| 162 | Ga0466714_031196 | 3300042603 | Bacteria | 2316 |
| 163 | Ga0466714_084747 | 3300042603 | Bacteria | 2763 |
| 164 | Ga0466722_266327 | 3300042609 | Bacteria | 4526 |
| 165 | Ga0466698_266502 | 3300042610 | Bacteria | 1036 |
| 166 | Ga0466698_337619 | 3300042610 | Bacteria | 2413 |
| 167 | Ga0466705_517113 | 3300042612 | Bacteria | 2254 |
| 168 | Ga0466715_309594 | 3300042616 | Bacteria | 109113 |
| 169 | Ga0466723_103516 | 3300042618 | Unclassified | 1842 |
| 170 | Ga0466723_373795 | 3300042618 | Bacteria | 21104 |
| 171 | Ga0466734_082139 | 3300042623 | Bacteria | 1352 |
| 172 | Ga0466703_429535 | 3300042636 | Bacteria | 36032 |
| 173 | Ga0466725_025183 | 3300042654 | Bacteria | 7204 |
| 174 | Ga0466725_082702 | 3300042654 | Bacteria | 32093 |
| 175 | Ga0466725_219529 | 3300042654 | Bacteria | 1983 |
| 176 | Ga0466725_346621 | 3300042654 | Bacteria | 12162 |
| 177 | Ga0466725_392948 | 3300042654 | Bacteria | 12450 |
| 178 | Ga0160430_117647 | 3300012852 | Bacteria | 1035 |
| 179 | Ga0415639_003901 | 3300038395 | Bacteria | 4353 |
| 180 | Ga0466693_101882 | 3300042592 | Bacteria | 1055 |
| 181 | Ga0466695_346149 | 3300042595 | Bacteria | 2275 |
| 182 | Ga0466696_003608 | 3300042596 | Bacteria | 10415 |
| 183 | Ga0466705_312193 | 3300042612 | Bacteria | 1364 |
| 184 | Ga0123355_10002085 | 3300009826 | Bacteria | 28219 |
| 185 | Ga0123355_10002132 | 3300009826 | Bacteria | 27941 |
| 186 | Ga0123355_10013785 | 3300009826 | Bacteria | 12596 |
| 187 | Ga0123355_10025603 | 3300009826 | Bacteria | 9501 |
| 188 | Ga0123355_10121263 | 3300009826 | Bacteria | 4055 |
| 189 | Ga0123355_10124558 | 3300009826 | Bacteria | 3986 |
| 190 | Ga0123355_10174281 | 3300009826 | Bacteria | 3207 |
| 191 | Ga0123355_10183437 | 3300009826 | Bacteria | 3101 |
| 192 | Ga0123355_10265164 | 3300009826 | Bacteria | 2396 |
| 193 | Ga0123355_10399561 | 3300009826 | Bacteria | 1774 |
| 194 | Ga0123355_10569059 | 3300009826 | Bacteria | 1361 |
| 195 | Ga0123355_10687867 | 3300009826 | Unclassified | 1179 |
| 196 | Ga0123355_10709740 | 3300009826 | Bacteria | 1151 |
| 197 | Ga0123355_10742174 | 3300009826 | Bacteria | 1113 |
| 198 | Ga0123355_10814727 | 3300009826 | Unclassified | 1037 |
| 199 | Ga0123355_11709824 | 3300009826 | Bacteria | 599 |
| 200 | Ga0123356_10035086 | 3300010049 | Bacteria | 4687 |
| 201 | Ga0123356_10236071 | 3300010049 | Bacteria | 1896 |
| 202 | Ga0123356_10341522 | 3300010049 | Bacteria | 1618 |
| 203 | Ga0123356_10958645 | 3300010049 | Bacteria | 1026 |
| 204 | Ga0123353_10000701 | 3300010167 | Bacteria | 40961 |
| 205 | IMNBL1DRAFT_c0000388 | 3300000062 | Bacteria | 37738 |
| 206 | AustNasuHG_c1000417 | 3300000089 | Bacteria | 14762 |
| 207 | Ga0068305_10004424 | 3300005083 | Bacteria | 7346 |
| 208 | Ga0466706_152943 | 3300042599 | Bacteria | 48130 |
| 209 | Ga0466707_307257 | 3300042601 | Bacteria | 1803 |
| 210 | Ga0466713_152148 | 3300042602 | Bacteria | 2156 |
| 211 | Ga0466714_136654 | 3300042603 | Bacteria | 17666 |
| 212 | Ga0466717_076972 | 3300042604 | Bacteria | 3449 |
| 213 | Ga0466716_180429 | 3300042605 | Bacteria | 17905 |
| 214 | Ga0466719_285091 | 3300042606 | Bacteria | 30775 |
| 215 | Ga0466721_324065 | 3300042608 | Bacteria | 4592 |
| 216 | Ga0466715_472158 | 3300042616 | Bacteria | 4829 |
| 217 | Ga0466728_081375 | 3300042620 | Bacteria | 20964 |
| 218 | Ga0466702_377112 | 3300042635 | Bacteria | 2045 |
| 219 | Ga0160440_102685 | 3300012815 | Unclassified | 1808 |
| 220 | Ga0160431_103518 | 3300012828 | Bacteria | 3180 |
| 221 | Ga0160448_103127 | 3300012854 | Bacteria | 4930 |
| 222 | Ga0415639_025241 | 3300038395 | Bacteria | 3877 |
| 223 | Ga0415639_034433 | 3300038395 | Bacteria | 11352 |
| 224 | Ga0415639_040485 | 3300038395 | Unclassified | 1517 |
| 225 | Ga0415639_086012 | 3300038395 | Bacteria | 1661 |
| 226 | Ga0466693_247797 | 3300042592 | Bacteria | 5415 |
| 227 | Ga0123357_10113798 | 3300009784 | Unclassified | 3438 |
| 228 | Ga0123357_10430768 | 3300009784 | Unclassified | 1166 |
| 229 | Ga0123355_10000566 | 3300009826 | Bacteria | 49780 |
| 230 | Ga0123355_10000635 | 3300009826 | Bacteria | 47525 |
| 231 | Ga0123355_10001214 | 3300009826 | Bacteria | 35876 |
| 232 | Ga0123355_10004644 | 3300009826 | Bacteria | 19983 |
| 233 | Ga0123355_10078415 | 3300009826 | Bacteria | 5278 |
| 234 | Ga0123355_10105521 | 3300009826 | Bacteria | 4421 |
| 235 | Ga0123355_10117741 | 3300009826 | Bacteria | 4130 |
| 236 | Ga0123355_10269057 | 3300009826 | Bacteria | 2371 |
| 237 | Ga0123355_10464447 | 3300009826 | Unclassified | 1586 |
| 238 | Ga0123355_10606525 | 3300009826 | Unclassified | 1296 |
| 239 | Ga0123355_10643414 | 3300009826 | Bacteria | 1240 |
| 240 | Ga0123355_10775419 | 3300009826 | Bacteria | 1077 |
| 241 | Ga0123355_10824342 | 3300009826 | Bacteria | 1028 |
| 242 | Ga0123355_10890048 | 3300009826 | Unclassified | 970 |
| 243 | Ga0123355_11250861 | 3300009826 | Bacteria | 751 |
| 244 | Ga0123355_11438229 | 3300009826 | Bacteria | 678 |
| 245 | Ga0123356_10018985 | 3300010049 | Bacteria | 6523 |
| 246 | Ga0123356_10061312 | 3300010049 | Bacteria | 3513 |
| 247 | Ga0123356_11718260 | 3300010049 | Unclassified | 779 |
| 248 | Ga0123353_10040521 | 3300010167 | Bacteria | 7350 |
| 249 | Ga0123353_10740910 | 3300010167 | Bacteria | 1370 |
| 250 | Ga0123354_10469025 | 3300010882 | Unclassified | 1005 |
| 251 | Ga0123354_10666470 | 3300010882 | Bacteria | 738 |
| 252 | AglaG_contig20166 | 2084038013 | Bacteria | 939 |
| 253 | JGI24700J35501_10930794 | 3300002508 | Bacteria | 24253 |
| 254 | Ga0072941_1011233 | 3300005201 | Bacteria | 7205 |
| 255 | Ga0102734_1067039 | 3300007129 | Bacteria | 926 |
| 256 | Ga0466707_028429 | 3300042601 | Bacteria | 3027 |
| 257 | Ga0466707_048054 | 3300042601 | Bacteria | 11948 |
| 258 | Ga0466707_080865 | 3300042601 | Bacteria | 320076 |
| 259 | Ga0466707_340159 | 3300042601 | Bacteria | 38548 |
| 260 | Ga0466707_370937 | 3300042601 | Bacteria | 1955 |
| 261 | Ga0466707_406957 | 3300042601 | Bacteria | 2995 |
| 262 | Ga0466713_030327 | 3300042602 | Bacteria | 42897 |
| 263 | Ga0466722_240797 | 3300042609 | Bacteria | 12349 |
| 264 | Ga0466715_156583 | 3300042616 | Bacteria | 1675 |
| 265 | Ga0466703_381858 | 3300042636 | Bacteria | 4954 |
| 266 | Ga0466704_384191 | 3300042643 | Bacteria | 24599 |
| 267 | Ga0466708_135960 | 3300042652 | Bacteria | 21988 |
| 268 | Ga0223682_1006933 | 3300021231 | Bacteria | 1624 |
| 269 | Ga0466691_117995 | 3300042593 | Bacteria | 3724 |
| 270 | Ga0466696_077439 | 3300042596 | Bacteria | 9380 |
| 271 | Ga0562377_0005 | 3300056842 | Bacteria | 3519381 |
| 272 | Ga0123355_10003449 | 3300009826 | Bacteria | 22687 |
| 273 | Ga0123355_10062967 | 3300009826 | Bacteria | 5985 |
| 274 | Ga0123355_10129327 | 3300009826 | Bacteria | 3894 |
| 275 | Ga0123355_10273471 | 3300009826 | Bacteria | 2343 |
| 276 | Ga0123355_10499185 | 3300009826 | Bacteria | 1502 |
| 277 | Ga0123355_10931556 | 3300009826 | Bacteria | 937 |
| 278 | Ga0123356_10748458 | 3300010049 | Bacteria | 1147 |
| 279 | Ga0123353_10234901 | 3300010167 | Bacteria | 2855 |
| 280 | Ga0123353_10413719 | 3300010167 | Bacteria | 2001 |
| 281 | Ga0123354_10035125 | 3300010882 | Bacteria | 7830 |
| 282 | Ga0123354_10148468 | 3300010882 | Unclassified | 2855 |
| 283 | Ga0072941_1023993 | 3300005201 | Bacteria | 10451 |
| 284 | Ga0466713_014023 | 3300042602 | Bacteria | 32520 |
| 285 | Ga0466714_089269 | 3300042603 | Bacteria | 1408 |
| 286 | Ga0466716_461428 | 3300042605 | Unclassified | 7434 |
| 287 | Ga0466722_193513 | 3300042609 | Bacteria | 5276 |
| 288 | Ga0466711_241048 | 3300042615 | Bacteria | 1474 |
| 289 | Ga0466715_226700 | 3300042616 | Bacteria | 7277 |
| 290 | Ga0466715_232257 | 3300042616 | Bacteria | 9357 |
| 291 | Ga0466734_028831 | 3300042623 | Bacteria | 1248 |
| 292 | Ga0466734_115140 | 3300042623 | Bacteria | 1603 |
| 293 | Ga0466702_379091 | 3300042635 | Bacteria | 5054 |
| 294 | Ga0466704_360774 | 3300042643 | Bacteria | 10006 |
| 295 | Ga0466704_556176 | 3300042643 | Bacteria | 31395 |
| 296 | Ga0160430_115743 | 3300012852 | Unclassified | 1139 |
| 297 | Ga0466693_149992 | 3300042592 | Bacteria | 2620 |
| 298 | Ga0466693_332178 | 3300042592 | Unclassified | 1254 |
| 299 | Ga0466693_346010 | 3300042592 | Bacteria | 4583 |
| 300 | Ga0466693_417454 | 3300042592 | Unclassified | 1420 |
| 301 | Ga0466696_332030 | 3300042596 | Bacteria | 4990 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00347 | Ribosomal_L6 | Ribosomal protein L6 | 42 | 114 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.