Protein Family IF03469

Metagenome Metatranscriptome Isolate
392 Members
158 Samples
301 Scaffolds
179.64 Avg Length

🧬 Representative Sequence

ID
3300010882|Ga0123354_10012254|Ga0123354_1001225418
Length
212 aa
Sequence
LLASESRFKALVYELFQALGSRFQHLVRRQTMSRIGKLPIPVPAGVDVKIDEGNMLTIKGPKGTLSRKLSADMHIAMDNGVLTVERPNDLKKFKSLHGLTRTLINNMVDGVTKGFSKTLEIAGVGYRAAKSGNELTLTLGYSHPIKMVDPDGITTTVDGTNKITVSGIDKEKVGQHAANIRSKRAIEPYNAKGIKYSNEKVRRKVGKTGKK*

πŸ“Š Sample Types

Isolate 23.2%
Metagenome 76.0%
MAG 0.0%
Metatranscriptome 0.8%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 39.2%
Termitidae 19.6%
Kalotermitidae 9.8%
Blattidae 9.2%
Anthocoridae 6.5%
Tenebrionidae 2.6%
Rhinotermitidae 2.0%
Dytiscidae 2.0%
Culicidae 1.3%
Cambaridae 1.3%
Armadillidiidae 1.3%
Passalidae 1.3%
Hodotermitidae 0.7%
Scarabaeidae 0.7%
Cerambycidae 0.7%
Chironomidae 0.7%
Termopsidae 0.7%
Formicidae 0.7%

🌳 Taxonomy

Archaea 0
Bacteria 364
Eukaryota 0
Viruses 0
Unclassified 28

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820944107 Unclassified Actinobacteria Cu122P5bin14 Isolate Unclassified
2 2940264388 Lachnospiraceae bacterium PFB1-17 Isolate Blattidae
3 2940267548 Lachnospiraceae bacterium PFB1-22 Isolate Blattidae
4 2940280053 Lachnospiraceae bacterium PF1-22 Isolate Blattidae
5 2944625312 Dysgonomonas sp. PF1-3 Isolate Blattidae
6 2820275298 Unclassified Firmicutes Th196P3bin17 Isolate Unclassified
7 2820435670 Unclassified Firmicutes Lab288P3bin217 Isolate Unclassified
8 2820457604 Unclassified Firmicutes Lab288P3bin15 Isolate Unclassified
9 2820602899 Unclassified Firmicutes Emb289P1bin51 Isolate Unclassified
10 2820709481 Unclassified Firmicutes Co191P1bin30 Isolate Unclassified
11 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
12 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
13 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
14 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
15 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
16 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
17 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
18 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
19 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
20 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
21 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
22 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
23 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
24 2847305884 Microbacterium protaetiae DFW100M-13 Isolate Scarabaeidae
25 2894981435 Leucobacter sp. OLDS2 Isolate Anthocoridae
26 2940286528 Lachnospiraceae bacterium PFB1-21 Isolate Blattidae
27 2084038013 Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae Metagenome Cerambycidae
28 2820371985 Unclassified Firmicutes Nt197P3bin100 Isolate Unclassified
29 2820469612 Unclassified Firmicutes Lab288P1bin92 Isolate Unclassified
30 2820499546 Unclassified Firmicutes Lab288P1bin54 Isolate Unclassified
31 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
32 2820541116 Unclassified Firmicutes Lab288P1bin109 Isolate Unclassified
33 2820644600 Unclassified Firmicutes Cu122P5bin39 Isolate Unclassified
34 2820654856 Unclassified Firmicutes Cu122P1bin2 Isolate Unclassified
35 2820671341 Unclassified Firmicutes Co191P3bin20 Isolate Unclassified
36 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
37 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
38 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
39 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
40 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
41 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
42 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
43 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
44 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
45 3300022820 Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA Metatranscriptome Termitidae
46 2820807258 Unclassified Actinobacteria Nt197P3bin90 Isolate Unclassified
47 2820889385 Unclassified Actinobacteria Lab288P1bin133 Isolate Unclassified
48 2894944011 Leucobacter sp. OLAS13 Isolate Anthocoridae
49 2915166107 Leucobacter sp. cx-87 Isolate Cambaridae
50 2940230426 Lachnospiraceae bacterium PH5-48 Isolate Blattidae
51 2940283334 Lachnospiraceae bacterium PF1-4 Isolate Blattidae
52 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
53 2820385248 Unclassified Firmicutes Nt197P1bin19 Isolate Unclassified
54 2820487239 Unclassified Firmicutes Lab288P1bin71 Isolate Unclassified
55 2820492969 Unclassified Firmicutes Lab288P1bin6 Isolate Unclassified
56 2820539610 Unclassified Firmicutes Lab288P1bin136 Isolate Unclassified
57 2820673891 Unclassified Firmicutes Co191P3bin18 Isolate Unclassified
58 2820676843 Unclassified Firmicutes Co191P3bin17 Isolate Unclassified
59 2820713307 Unclassified Firmicutes Co191P1bin2 Isolate Unclassified
60 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
61 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
62 651324002 Acetonema longum APO-1, DSM 6540 Isolate Kalotermitidae
63 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
64 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
65 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
66 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
67 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
68 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
69 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
70 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
71 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
72 2820934415 Unclassified Actinobacteria Emb289P1bin68 Isolate Unclassified
73 2894926108 Leucobacter sp. OLES1 Isolate Anthocoridae
74 2940277027 Lachnospiraceae bacterium PF1-21 Isolate Blattidae
75 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
76 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
77 2820418027 Unclassified Firmicutes Lab288P3bin85 Isolate Unclassified
78 2820630457 Unclassified Firmicutes Emb289P1bin119 Isolate Unclassified
79 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
80 8030347546 Propionimicrobium sp. PCR01-08-3 Isolate Tenebrionidae
81 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
82 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
83 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
84 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
85 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
86 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
87 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
88 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
89 3300022232 Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA Metatranscriptome Termitidae
90 2894932631 Leucobacter sp. OAMLP11 Isolate Anthocoridae
91 2894966443 Leucobacter sp. OLCALW19 Isolate Anthocoridae
92 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
93 2524023214 Leucobacter chironomi DSM 19883 Isolate Chironomidae
94 2820238527 Unclassified Firmicutes Th196P3bin90 Isolate Unclassified
95 2820316744 Unclassified Firmicutes Nt197P3bin99 Isolate Unclassified
96 2820481688 Unclassified Firmicutes Lab288P1bin76 Isolate Unclassified
97 2820490862 Unclassified Firmicutes Lab288P1bin64 Isolate Unclassified
98 2820537337 Unclassified Firmicutes Lab288P1bin137 Isolate Unclassified
99 2820623020 Unclassified Firmicutes Emb289P1bin126 Isolate Unclassified
100 2820685979 Unclassified Firmicutes Co191P1bin81 Isolate Unclassified
101 2820696217 Unclassified Firmicutes Co191P1bin66 Isolate Unclassified
102 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
103 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
104 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
105 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
106 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
107 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
108 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
109 2820863028 Unclassified Actinobacteria Lab288P3bin164 Isolate Unclassified
110 2820899690 Unclassified Actinobacteria Emb289P4bin9 Isolate Unclassified
111 2873617540 Leucobacter insecticola HDW9B Isolate Dytiscidae
112 2894900265 Leucobacter sp. OLTLW20 Isolate Anthocoridae
113 2894929448 Leucobacter sp. OAMSW11 Isolate Anthocoridae
114 2915168811 Leucobacter sp. cx-169 Isolate Cambaridae
115 2940273867 Lachnoclostridium sp. PH1-16 Isolate Blattidae
116 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
117 2820375548 Unclassified Firmicutes Nt197P1bin8 Isolate Unclassified
118 2820408893 Unclassified Firmicutes Lab288P4bin80 Isolate Unclassified
119 2820094617 Unclassified Proteobacteria Lab288P3bin216 Isolate Unclassified
120 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
121 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
122 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
123 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
124 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
125 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
126 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
127 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
128 2873614151 Leucobacter viscericola HDW9C Isolate Dytiscidae
129 2894897082 Leucobacter sp. OLCS4 Isolate Anthocoridae
130 2894974975 Leucobacter sp. OLIS6 Isolate Anthocoridae
131 2940270707 Lachnoclostridium sp. PF1-13 Isolate Blattidae
132 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
133 2820378768 Unclassified Firmicutes Nt197P1bin7 Isolate Unclassified
134 2820382897 Unclassified Firmicutes Nt197P1bin3 Isolate Unclassified
135 2820513949 Unclassified Firmicutes Lab288P1bin39 Isolate Unclassified
136 2820535361 Unclassified Firmicutes Lab288P1bin14 Isolate Unclassified
137 2820617402 Unclassified Firmicutes Emb289P1bin131 Isolate Unclassified
138 2820627938 Unclassified Firmicutes Emb289P1bin122 Isolate Unclassified
139 2820693137 Unclassified Firmicutes Co191P1bin70 Isolate Unclassified
140 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
141 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
142 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
143 2820829137 Unclassified Actinobacteria Nc150P5bin2 Isolate Unclassified
144 2820911766 Unclassified Actinobacteria Emb289P3bin96 Isolate Unclassified
145 2873620646 Leucobacter coleopterorum HDW9A Isolate Dytiscidae
146 2894935787 Leucobacter sp. OLJS4 Isolate Anthocoridae
147 2940233634 Lachnoclostridium sp. PF5-10 Isolate Blattidae
148 2816332114 Microbacterium saperdae DSM 20169 Isolate Unclassified
149 2820309449 Unclassified Firmicutes Th196P1bin10 Isolate Unclassified
150 2820347164 Unclassified Firmicutes Nt197P3bin58 Isolate Unclassified
151 2820380671 Unclassified Firmicutes Nt197P1bin4 Isolate Unclassified
152 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
153 2820600392 Unclassified Firmicutes Emb289P1bin52 Isolate Unclassified
154 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
155 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
156 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
157 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
158 3300021231 Termite gut microbial communities from nest - French Guiana - 10-1 mRNA SA Metatranscriptome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_061344 3300042612 Bacteria 17468
2 Ga0466705_244395 3300042612 Bacteria 7115
3 Ga0562374_0162 3300057007 Bacteria 154514
4 Ga0123357_10009986 3300009784 Bacteria 12028
5 Ga0123355_10000168 3300009826 Bacteria 79476
6 Ga0123355_10002703 3300009826 Bacteria 25128
7 Ga0123355_10042480 3300009826 Bacteria 7400
8 Ga0123355_10164231 3300009826 Bacteria 3337
9 Ga0123355_10438575 3300009826 Bacteria 1655
10 Ga0123355_10490543 3300009826 Bacteria 1522
11 Ga0123355_10757471 3300009826 Bacteria 1096
12 Ga0123355_10905183 3300009826 Bacteria 958
13 Ga0123356_10000406 3300010049 Bacteria 48995
14 Ga0123353_10123947 3300010167 Bacteria 4153
15 Ga0123353_10142855 3300010167 Unclassified 3832
16 Ga0123353_10316635 3300010167 Bacteria 2370
17 Ga0123353_11357565 3300010167 Unclassified 918
18 Ga0123354_10012254 3300010882 Bacteria 13287
19 Ga0123354_10239766 3300010882 Bacteria 1869
20 2227465192 2225789004 Unclassified 5212
21 JGI24695J34938_10195322 3300002450 Unclassified 842
22 JGI24703J35330_11748269 3300002501 Bacteria 12890
23 JGI24703J35330_11748512 3300002501 Bacteria 18286
24 Ga0068305_10002308 3300005083 Bacteria 45236
25 Ga0123357_10001723 3300009784 Bacteria 23593
26 Ga0466706_103864 3300042599 Bacteria 13046
27 Ga0466700_424753 3300042600 Bacteria 1684
28 Ga0466707_238916 3300042601 Bacteria 2869
29 Ga0466719_086513 3300042606 Bacteria 15067
30 Ga0466719_203918 3300042606 Bacteria 15671
31 Ga0466715_416878 3300042616 Bacteria 48123
32 Ga0466709_323155 3300042648 Bacteria 19411
33 Ga0466724_27243 3300042649 Bacteria 6777
34 Ga0466725_438088 3300042654 Bacteria 2316
35 Ga0160457_1002026 3300012858 Bacteria 4717
36 Ga0233288_1002950 3300022232 Bacteria 1945
37 Ga0415639_000644 3300038395 Bacteria 27607
38 Ga0415639_040961 3300038395 Bacteria 2726
39 Ga0466693_061563 3300042592 Bacteria 1153
40 Ga0466691_068792 3300042593 Bacteria 18041
41 Ga0466694_203013 3300042594 Bacteria 1183
42 Ga0466696_088894 3300042596 Bacteria 1583
43 Ga0123357_10183998 3300009784 Bacteria 2430
44 Ga0123357_10286276 3300009784 Bacteria 1692
45 Ga0123357_10353818 3300009784 Bacteria 1401
46 Ga0123355_10000164 3300009826 Bacteria 81449
47 Ga0123355_10000459 3300009826 Bacteria 53637
48 Ga0123355_10000550 3300009826 Bacteria 50132
49 Ga0123355_10001096 3300009826 Bacteria 37400
50 Ga0123355_10003105 3300009826 Bacteria 23706
51 Ga0123355_10046376 3300009826 Bacteria 7068
52 Ga0123355_10062748 3300009826 Bacteria 5996
53 Ga0123355_10176176 3300009826 Bacteria 3184
54 Ga0123355_10270815 3300009826 Bacteria 2360
55 Ga0123355_11272983 3300009826 Unclassified 741
56 Ga0123356_10137916 3300010049 Bacteria 2402
57 Ga0123356_11318668 3300010049 Bacteria 885
58 Ga0123356_11777577 3300010049 Bacteria 766
59 Ga0123353_10000688 3300010167 Bacteria 41343
60 Ga0123353_10073386 3300010167 Bacteria 5499
61 Ga0123354_10132915 3300010882 Bacteria 3132
62 Ga0123354_10178056 3300010882 Bacteria 2440
63 JGI24695J34938_10003848 3300002450 Bacteria 10185
64 JGI24703J35330_11748514 3300002501 Bacteria 18343
65 Ga0072940_1148542 3300005200 Bacteria 5134
66 Ga0466706_066171 3300042599 Bacteria 2857
67 Ga0466706_094432 3300042599 Bacteria 10061
68 Ga0466700_426729 3300042600 Bacteria 1439
69 Ga0466707_098926 3300042601 Bacteria 16720
70 Ga0466713_016024 3300042602 Bacteria 5771
71 Ga0466714_111479 3300042603 Bacteria 8086
72 Ga0466721_139283 3300042608 Bacteria 240312
73 Ga0466721_155290 3300042608 Bacteria 1524
74 Ga0466715_583568 3300042616 Bacteria 2849
75 Ga0466723_104883 3300042618 Bacteria 18998
76 Ga0466729_077403 3300042621 Bacteria 1825
77 Ga0466702_149568 3300042635 Bacteria 1170
78 Ga0160441_101991 3300012825 Bacteria 4768
79 Ga0160458_121692 3300012832 Bacteria 659
80 Ga0160433_109159 3300012846 Unclassified 1305
81 Ga0415639_011215 3300038395 Bacteria 3506
82 Ga0415639_033820 3300038395 Bacteria 8317
83 Ga0415639_059431 3300038395 Bacteria 1484
84 Ga0415639_098037 3300038395 Bacteria 1824
85 Ga0466690_184185 3300042590 Bacteria 17569
86 Ga0466692_067952 3300042591 Bacteria 1722
87 Ga0123357_10186465 3300009784 Bacteria 2405
88 Ga0123355_10102229 3300009826 Bacteria 4508
89 Ga0123355_10214115 3300009826 Bacteria 2785
90 Ga0123355_10372185 3300009826 Unclassified 1870
91 Ga0123355_10685496 3300009826 Unclassified 1182
92 Ga0123355_10864329 3300009826 Bacteria 992
93 Ga0123356_10004286 3300010049 Bacteria 14755
94 Ga0123356_10007080 3300010049 Bacteria 11238
95 Ga0123356_10121603 3300010049 Bacteria 2540
96 Ga0123356_10659050 3300010049 Bacteria 1214
97 Ga0123353_10482987 3300010167 Bacteria 1812
98 Ga0123354_10192517 3300010882 Bacteria 2277
99 IMNBL1DRAFT_c0041742 3300000062 Bacteria 1537
100 JGI24698J34947_10071146 3300002449 Bacteria 1671
101 JGI24703J35330_11748024 3300002501 Unclassified 9993
102 JGI24703J35330_11748775 3300002501 Bacteria 33848
103 JGI24705J35276_12076960 3300002504 Bacteria 965
104 JGI24705J35276_12238395 3300002504 Bacteria 20949
105 Ga0466706_126733 3300042599 Bacteria 4299
106 Ga0466719_393574 3300042606 Bacteria 1499
107 Ga0466715_075583 3300042616 Bacteria 81099
108 Ga0466728_155355 3300042620 Bacteria 2584
109 Ga0255809_1018313 3300022820 Bacteria 1364
110 Ga0415639_047619 3300038395 Bacteria 1822
111 Ga0415639_196800 3300038395 Bacteria 2325
112 Ga0466692_014686 3300042591 Bacteria 11280
113 Ga0466692_103556 3300042591 Bacteria 1077
114 Ga0466693_198069 3300042592 Bacteria 4338
115 Ga0466699_044569 3300042597 Bacteria 1782
116 Ga0123357_10135418 3300009784 Bacteria 3049
117 Ga0123355_10029089 3300009826 Bacteria 8939
118 Ga0123355_10067585 3300009826 Bacteria 5750
119 Ga0123355_10104004 3300009826 Bacteria 4461
120 Ga0123355_10746346 3300009826 Bacteria 1108
121 Ga0123356_10438664 3300010049 Bacteria 1452
122 Ga0123353_10021067 3300010167 Bacteria 9769
123 Ga0123353_10153004 3300010167 Bacteria 3681
124 Ga0123353_10884600 3300010167 Unclassified 1219
125 JGI24695J34938_10000403 3300002450 Bacteria 42148
126 JGI24695J34938_10019246 3300002450 Bacteria 3390
127 JGI24702J35022_10016005 3300002462 Bacteria 4118
128 JGI24705J35276_12238288 3300002504 Bacteria 18560
129 Ga0466700_314307 3300042600 Bacteria 2755
130 Ga0466705_475066 3300042612 Bacteria 3002
131 Ga0466715_162043 3300042616 Bacteria 36555
132 Ga0466723_034529 3300042618 Bacteria 4842
133 Ga0466726_324507 3300042619 Bacteria 16558
134 Ga0466703_124494 3300042636 Bacteria 7732
135 Ga0466705_087864 3300042612 Bacteria 1573
136 Ga0562379_0066 3300056790 Bacteria 440869
137 Ga0123357_10535211 3300009784 Bacteria 946
138 Ga0123355_10010920 3300009826 Bacteria 13973
139 Ga0123355_10034985 3300009826 Bacteria 8165
140 Ga0123355_10076902 3300009826 Unclassified 5336
141 Ga0123355_10138528 3300009826 Bacteria 3732
142 Ga0123355_10254859 3300009826 Bacteria 2464
143 Ga0123355_10337212 3300009826 Bacteria 2013
144 Ga0123355_10439593 3300009826 Bacteria 1652
145 Ga0123356_10072787 3300010049 Bacteria 3230
146 Ga0123356_10170057 3300010049 Bacteria 2189
147 Ga0123356_10908278 3300010049 Bacteria 1052
148 Ga0123356_11260122 3300010049 Bacteria 904
149 Ga0123356_12233730 3300010049 Bacteria 684
150 Ga0123353_10012572 3300010167 Bacteria 12051
151 Ga0123353_10020258 3300010167 Bacteria 9926
152 Ga0123353_10915450 3300010167 Bacteria 1192
153 Ga0123354_10026362 3300010882 Bacteria 9168
154 2227322174 2225789004 Bacteria 1186
155 IMNBL1DRAFT_c0003268 3300000062 Bacteria 10563
156 JGI24703J35330_11196848 3300002501 Bacteria 759
157 JGI24705J35276_12219479 3300002504 Bacteria 2207
158 Ga0466706_040771 3300042599 Bacteria 18519
159 Ga0466706_161420 3300042599 Bacteria 8833
160 Ga0466707_403509 3300042601 Bacteria 3464
161 Ga0466714_012747 3300042603 Bacteria 29171
162 Ga0466714_031196 3300042603 Bacteria 2316
163 Ga0466714_084747 3300042603 Bacteria 2763
164 Ga0466722_266327 3300042609 Bacteria 4526
165 Ga0466698_266502 3300042610 Bacteria 1036
166 Ga0466698_337619 3300042610 Bacteria 2413
167 Ga0466705_517113 3300042612 Bacteria 2254
168 Ga0466715_309594 3300042616 Bacteria 109113
169 Ga0466723_103516 3300042618 Unclassified 1842
170 Ga0466723_373795 3300042618 Bacteria 21104
171 Ga0466734_082139 3300042623 Bacteria 1352
172 Ga0466703_429535 3300042636 Bacteria 36032
173 Ga0466725_025183 3300042654 Bacteria 7204
174 Ga0466725_082702 3300042654 Bacteria 32093
175 Ga0466725_219529 3300042654 Bacteria 1983
176 Ga0466725_346621 3300042654 Bacteria 12162
177 Ga0466725_392948 3300042654 Bacteria 12450
178 Ga0160430_117647 3300012852 Bacteria 1035
179 Ga0415639_003901 3300038395 Bacteria 4353
180 Ga0466693_101882 3300042592 Bacteria 1055
181 Ga0466695_346149 3300042595 Bacteria 2275
182 Ga0466696_003608 3300042596 Bacteria 10415
183 Ga0466705_312193 3300042612 Bacteria 1364
184 Ga0123355_10002085 3300009826 Bacteria 28219
185 Ga0123355_10002132 3300009826 Bacteria 27941
186 Ga0123355_10013785 3300009826 Bacteria 12596
187 Ga0123355_10025603 3300009826 Bacteria 9501
188 Ga0123355_10121263 3300009826 Bacteria 4055
189 Ga0123355_10124558 3300009826 Bacteria 3986
190 Ga0123355_10174281 3300009826 Bacteria 3207
191 Ga0123355_10183437 3300009826 Bacteria 3101
192 Ga0123355_10265164 3300009826 Bacteria 2396
193 Ga0123355_10399561 3300009826 Bacteria 1774
194 Ga0123355_10569059 3300009826 Bacteria 1361
195 Ga0123355_10687867 3300009826 Unclassified 1179
196 Ga0123355_10709740 3300009826 Bacteria 1151
197 Ga0123355_10742174 3300009826 Bacteria 1113
198 Ga0123355_10814727 3300009826 Unclassified 1037
199 Ga0123355_11709824 3300009826 Bacteria 599
200 Ga0123356_10035086 3300010049 Bacteria 4687
201 Ga0123356_10236071 3300010049 Bacteria 1896
202 Ga0123356_10341522 3300010049 Bacteria 1618
203 Ga0123356_10958645 3300010049 Bacteria 1026
204 Ga0123353_10000701 3300010167 Bacteria 40961
205 IMNBL1DRAFT_c0000388 3300000062 Bacteria 37738
206 AustNasuHG_c1000417 3300000089 Bacteria 14762
207 Ga0068305_10004424 3300005083 Bacteria 7346
208 Ga0466706_152943 3300042599 Bacteria 48130
209 Ga0466707_307257 3300042601 Bacteria 1803
210 Ga0466713_152148 3300042602 Bacteria 2156
211 Ga0466714_136654 3300042603 Bacteria 17666
212 Ga0466717_076972 3300042604 Bacteria 3449
213 Ga0466716_180429 3300042605 Bacteria 17905
214 Ga0466719_285091 3300042606 Bacteria 30775
215 Ga0466721_324065 3300042608 Bacteria 4592
216 Ga0466715_472158 3300042616 Bacteria 4829
217 Ga0466728_081375 3300042620 Bacteria 20964
218 Ga0466702_377112 3300042635 Bacteria 2045
219 Ga0160440_102685 3300012815 Unclassified 1808
220 Ga0160431_103518 3300012828 Bacteria 3180
221 Ga0160448_103127 3300012854 Bacteria 4930
222 Ga0415639_025241 3300038395 Bacteria 3877
223 Ga0415639_034433 3300038395 Bacteria 11352
224 Ga0415639_040485 3300038395 Unclassified 1517
225 Ga0415639_086012 3300038395 Bacteria 1661
226 Ga0466693_247797 3300042592 Bacteria 5415
227 Ga0123357_10113798 3300009784 Unclassified 3438
228 Ga0123357_10430768 3300009784 Unclassified 1166
229 Ga0123355_10000566 3300009826 Bacteria 49780
230 Ga0123355_10000635 3300009826 Bacteria 47525
231 Ga0123355_10001214 3300009826 Bacteria 35876
232 Ga0123355_10004644 3300009826 Bacteria 19983
233 Ga0123355_10078415 3300009826 Bacteria 5278
234 Ga0123355_10105521 3300009826 Bacteria 4421
235 Ga0123355_10117741 3300009826 Bacteria 4130
236 Ga0123355_10269057 3300009826 Bacteria 2371
237 Ga0123355_10464447 3300009826 Unclassified 1586
238 Ga0123355_10606525 3300009826 Unclassified 1296
239 Ga0123355_10643414 3300009826 Bacteria 1240
240 Ga0123355_10775419 3300009826 Bacteria 1077
241 Ga0123355_10824342 3300009826 Bacteria 1028
242 Ga0123355_10890048 3300009826 Unclassified 970
243 Ga0123355_11250861 3300009826 Bacteria 751
244 Ga0123355_11438229 3300009826 Bacteria 678
245 Ga0123356_10018985 3300010049 Bacteria 6523
246 Ga0123356_10061312 3300010049 Bacteria 3513
247 Ga0123356_11718260 3300010049 Unclassified 779
248 Ga0123353_10040521 3300010167 Bacteria 7350
249 Ga0123353_10740910 3300010167 Bacteria 1370
250 Ga0123354_10469025 3300010882 Unclassified 1005
251 Ga0123354_10666470 3300010882 Bacteria 738
252 AglaG_contig20166 2084038013 Bacteria 939
253 JGI24700J35501_10930794 3300002508 Bacteria 24253
254 Ga0072941_1011233 3300005201 Bacteria 7205
255 Ga0102734_1067039 3300007129 Bacteria 926
256 Ga0466707_028429 3300042601 Bacteria 3027
257 Ga0466707_048054 3300042601 Bacteria 11948
258 Ga0466707_080865 3300042601 Bacteria 320076
259 Ga0466707_340159 3300042601 Bacteria 38548
260 Ga0466707_370937 3300042601 Bacteria 1955
261 Ga0466707_406957 3300042601 Bacteria 2995
262 Ga0466713_030327 3300042602 Bacteria 42897
263 Ga0466722_240797 3300042609 Bacteria 12349
264 Ga0466715_156583 3300042616 Bacteria 1675
265 Ga0466703_381858 3300042636 Bacteria 4954
266 Ga0466704_384191 3300042643 Bacteria 24599
267 Ga0466708_135960 3300042652 Bacteria 21988
268 Ga0223682_1006933 3300021231 Bacteria 1624
269 Ga0466691_117995 3300042593 Bacteria 3724
270 Ga0466696_077439 3300042596 Bacteria 9380
271 Ga0562377_0005 3300056842 Bacteria 3519381
272 Ga0123355_10003449 3300009826 Bacteria 22687
273 Ga0123355_10062967 3300009826 Bacteria 5985
274 Ga0123355_10129327 3300009826 Bacteria 3894
275 Ga0123355_10273471 3300009826 Bacteria 2343
276 Ga0123355_10499185 3300009826 Bacteria 1502
277 Ga0123355_10931556 3300009826 Bacteria 937
278 Ga0123356_10748458 3300010049 Bacteria 1147
279 Ga0123353_10234901 3300010167 Bacteria 2855
280 Ga0123353_10413719 3300010167 Bacteria 2001
281 Ga0123354_10035125 3300010882 Bacteria 7830
282 Ga0123354_10148468 3300010882 Unclassified 2855
283 Ga0072941_1023993 3300005201 Bacteria 10451
284 Ga0466713_014023 3300042602 Bacteria 32520
285 Ga0466714_089269 3300042603 Bacteria 1408
286 Ga0466716_461428 3300042605 Unclassified 7434
287 Ga0466722_193513 3300042609 Bacteria 5276
288 Ga0466711_241048 3300042615 Bacteria 1474
289 Ga0466715_226700 3300042616 Bacteria 7277
290 Ga0466715_232257 3300042616 Bacteria 9357
291 Ga0466734_028831 3300042623 Bacteria 1248
292 Ga0466734_115140 3300042623 Bacteria 1603
293 Ga0466702_379091 3300042635 Bacteria 5054
294 Ga0466704_360774 3300042643 Bacteria 10006
295 Ga0466704_556176 3300042643 Bacteria 31395
296 Ga0160430_115743 3300012852 Unclassified 1139
297 Ga0466693_149992 3300042592 Bacteria 2620
298 Ga0466693_332178 3300042592 Unclassified 1254
299 Ga0466693_346010 3300042592 Bacteria 4583
300 Ga0466693_417454 3300042592 Unclassified 1420
301 Ga0466696_332030 3300042596 Bacteria 4990

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00347 Ribosomal_L6 Ribosomal protein L6 42 114 0.98

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.