Protein Family IF03450

Metagenome Isolate
130 Members
72 Samples
115 Scaffolds
385.15 Avg Length

🧬 Representative Sequence

ID
3300010882|Ga0123354_10000306|Ga0123354_1000030624
Length
408 aa
Sequence
MSVTEKINKPDAPKTSFPMNGVDEALRKQIAILGSTGSIGTQALEVIEEQSDRFEVYALTANNNADLLIAQARKFEPEIVVIANEAKYDYVKESLKDLPIKVFAGTNSIAEVAEMQPVDIVLTAMVGYSGLQPTIHAVKAGKTIALANKETLVVAGDLICELAERHKSAILPVDSEHSAVFQCLAGEISPVEKIILTASGGPFRGKDRKFLEKVTPACALKHPNWEMGSKITIDSASLMNKGFEVIEAKWLFGVRPEQIEVVIHPQSLIHSMVQFEDGSIKAQIGLPDMKLPIQYAFAYPERIRNNYPRVDFFNCQSFTFEKPDLEVFRNLTFAYEAMRQKGNMPCILNAANEVVVAAFLQEQIGFLQMPDIIEKTMQIASYIAKPTYEEYVMTDKEAREIALSLCK*

📊 Sample Types

Isolate 11.5%
Metagenome 88.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 31.0%
Kalotermitidae 18.3%
Unclassified 16.9%
Armadillidiidae 11.3%
Blattidae 7.0%
Passalidae 4.2%
Rhinotermitidae 4.2%
Hodotermitidae 1.4%
Hydrophilidae 1.4%
Termopsidae 1.4%
Culicidae 1.4%
Drosophilidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 126
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820770630 Unclassified Bacteroidetes Lab288P3bin130 Isolate Unclassified
2 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
3 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
4 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
5 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
6 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
7 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
8 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
9 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
10 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
11 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
12 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
13 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
14 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
15 2820788205 Unclassified Bacteroidetes Emb289P1bin57 Isolate Unclassified
16 2820350530 Unclassified Firmicutes Nt197P3bin37 Isolate Unclassified
17 2820750388 Unclassified Bacteroidetes Nt197P3bin50 Isolate Unclassified
18 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
19 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
20 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
21 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
22 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
23 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
24 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
25 2820785563 Unclassified Bacteroidetes Emb289P1bin74 Isolate Unclassified
26 2820792843 Unclassified Bacteroidetes Cu122P3bin1 Isolate Unclassified
27 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
28 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
29 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
30 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
31 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
32 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
33 2820797595 Unclassified Bacteroidetes Co191P3bin3 Isolate Unclassified
34 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
35 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
36 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
37 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
38 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
39 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
40 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
41 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
42 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
43 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
44 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
45 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
46 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
47 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
48 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
49 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
50 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
51 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
52 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
53 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
54 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
55 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
56 2920168565 Paludibacter sp. 221 Isolate Blattidae
57 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
58 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
59 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
60 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
61 2820525019 Unclassified Firmicutes Lab288P1bin2 Isolate Unclassified
62 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
63 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae
64 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
65 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
66 643348524 Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 Isolate Unclassified
67 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
68 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
69 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
70 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
71 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
72 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466723_091519 3300042618 Bacteria 9163
2 Ga0466728_016849 3300042620 Bacteria 12533
3 Ga0466703_092827 3300042636 Bacteria 5772
4 Ga0466708_135441 3300042652 Bacteria 21711
5 Ga0466727_157863 3300042655 Bacteria 1617
6 Ga0160433_100727 3300012846 Unclassified 12304
7 Ga0160443_102292 3300012848 Bacteria 4462
8 Ga0466657_012559 3300042582 Bacteria 6171
9 Ga0466692_162937 3300042591 Bacteria 7543
10 Ga0466696_191055 3300042596 Bacteria 25014
11 Ga0466701_048164 3300042598 Unclassified 17037
12 Ga0466706_267636 3300042599 Bacteria 11078
13 Ga0466714_113270 3300042603 Bacteria 1615
14 Ga0123357_10005111 3300009784 Bacteria 15639
15 Ga0123355_10263587 3300009826 Bacteria 2406
16 Ga0123354_10000306 3300010882 Bacteria 45162
17 2227422480 2225789004 Bacteria 5619
18 IMNBL1DRAFT_c0004399 3300000062 Bacteria 8494
19 Ga0466733_073127 3300042659 Bacteria 14245
20 Ga0466733_173696 3300042659 Bacteria 6562
21 Ga0466704_030571 3300042643 Bacteria 29418
22 Ga0466724_22590 3300042649 Bacteria 29057
23 Ga0466727_032254 3300042655 Bacteria 4921
24 Ga0160457_1000009 3300012858 Bacteria 506736
25 Ga0466657_234260 3300042582 Bacteria 4253
26 Ga0466706_015316 3300042599 Bacteria 50470
27 Ga0466700_147394 3300042600 Bacteria 3761
28 Ga0466713_020244 3300042602 Bacteria 9360
29 Ga0466713_143719 3300042602 Bacteria 5199
30 Ga0466698_076124 3300042610 Bacteria 2655
31 Ga0123357_10037575 3300009784 Bacteria 6592
32 Ga0123355_10055197 3300009826 Bacteria 6433
33 Ga0123353_10260671 3300010167 Bacteria 2678
34 IMNBL1DRAFT_c0003107 3300000062 Bacteria 10953
35 JGI24696J40584_12961581 3300002834 Bacteria 22280
36 Ga0466732_103073 3300042656 Bacteria 41421
37 Ga0466705_421129 3300042612 Bacteria 8060
38 Ga0466703_135582 3300042636 Bacteria 15359
39 Ga0466704_530160 3300042643 Bacteria 4341
40 Ga0160455_100069 3300012837 Bacteria 184978
41 Ga0160444_102784 3300012841 Bacteria 2610
42 Ga0466701_057824 3300042598 Bacteria 22348
43 Ga0466713_095526 3300042602 Bacteria 106941
44 Ga0123353_10539975 3300010167 Bacteria 1685
45 IMNBGM34_c003021 3300000036 Bacteria 2365
46 JGI24702J35022_10008793 3300002462 Bacteria 5703
47 Ga0466733_204380 3300042659 Bacteria 28684
48 Ga0466715_384796 3300042616 Bacteria 6467
49 Ga0466723_112761 3300042618 Bacteria 2383
50 Ga0466729_257542 3300042621 Bacteria 1429
51 Ga0466704_067672 3300042643 Bacteria 8450
52 Ga0466727_207362 3300042655 Bacteria 6971
53 Ga0160467_100749 3300012829 Bacteria 23302
54 Ga0160459_105286 3300012831 Bacteria 1693
55 Ga0160443_100015 3300012848 Bacteria 436093
56 Ga0466656_054582 3300042550 Bacteria 6382
57 Ga0466694_160746 3300042594 Bacteria 6982
58 Ga0466713_029503 3300042602 Bacteria 16241
59 Ga0466714_082006 3300042603 Bacteria 191145
60 Ga0466716_028761 3300042605 Bacteria 9318
61 Ga0123355_10000179 3300009826 Bacteria 78580
62 Ga0123355_10026896 3300009826 Bacteria 9286
63 Ga0123356_10056569 3300010049 Bacteria 3655
64 Ga0123356_10149632 3300010049 Bacteria 2316
65 Ga0123353_10000082 3300010167 Bacteria 106066
66 Ga0466718_120149 3300042617 Bacteria 10097
67 Ga0466723_285590 3300042618 Bacteria 4883
68 Ga0466704_175619 3300042643 Bacteria 30013
69 Ga0466690_339108 3300042590 Bacteria 4175
70 Ga0466695_028814 3300042595 Bacteria 17443
71 Ga0466707_017877 3300042601 Bacteria 16904
72 Ga0466716_430332 3300042605 Bacteria 14125
73 Ga0466722_227624 3300042609 Bacteria 1806
74 Ga0123355_10405283 3300009826 Bacteria 1755
75 Ga0068305_10070135 3300005083 Bacteria 5925
76 Ga0466705_015572 3300042612 Bacteria 13659
77 Ga0466710_087623 3300042613 Bacteria 2382
78 Ga0466729_028506 3300042621 Bacteria 1468
79 Ga0466703_212909 3300042636 Bacteria 7708
80 Ga0466703_417664 3300042636 Bacteria 8952
81 Ga0160445_101765 3300012847 Bacteria 5663
82 Ga0466690_388556 3300042590 Bacteria 11669
83 Ga0466694_195710 3300042594 Bacteria 1519
84 Ga0466696_161539 3300042596 Bacteria 37941
85 Ga0466707_106635 3300042601 Bacteria 10385
86 Ga0123353_10121508 3300010167 Bacteria 4199
87 Ga0123353_10196311 3300010167 Bacteria 3181
88 Ga0466705_087900 3300042612 Bacteria 15463
89 Ga0466711_204784 3300042615 Bacteria 3896
90 Ga0466711_299592 3300042615 Bacteria 3610
91 Ga0466730_039992 3300042625 Bacteria 1355215
92 Ga0160432_100012 3300012818 Bacteria 390104
93 Ga0160433_100257 3300012846 Unclassified 37091
94 Ga0466657_019668 3300042582 Bacteria 3625
95 Ga0466691_070652 3300042593 Bacteria 38932
96 Ga0466696_220816 3300042596 Bacteria 2259
97 Ga0466719_099656 3300042606 Bacteria 8244
98 2227541589 2225789004 Bacteria 2983
99 Ga0104041_1000036 3300007106 Bacteria 3330
100 Ga0466705_071253 3300042612 Bacteria 10568
101 Ga0466711_023105 3300042615 Bacteria 1959
102 Ga0466715_341035 3300042616 Bacteria 3158
103 Ga0466734_018994 3300042623 Bacteria 8431
104 Ga0466704_234533 3300042643 Bacteria 9049
105 Ga0160469_102309 3300012824 Unclassified 3677
106 Ga0160445_101419 3300012847 Bacteria 6850
107 Ga0160443_100326 3300012848 Bacteria 44284
108 Ga0466692_008187 3300042591 Bacteria 121981
109 Ga0466706_139141 3300042599 Bacteria 4620
110 Ga0466714_154443 3300042603 Bacteria 8680
111 Ga0466722_048054 3300042609 Bacteria 48867
112 Ga0123355_10001479 3300009826 Bacteria 32715
113 Ga0123355_10006840 3300009826 Bacteria 16974
114 Ga0123353_10000110 3300010167 Bacteria 95473
115 Ga0123354_10129765 3300010882 Bacteria 3191

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase 30 156 0.99
PF08436 DXP_redisom_C 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain 170 252 0.98
PF13288 DXPR_C DXP reductoisomerase C-terminal domain 284 400 0.96

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02670 GO:0070402 NADPH binding MF
PF08436 GO:0005515 protein binding MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.