Protein Family IF03413

Metagenome Metatranscriptome Isolate
640 Members
228 Samples
515 Scaffolds
93.67 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_12299789|Ga0123353_122997892
Length
112 aa
Sequence
MGLRVGPAMTKPQERRNQMARSLKKGPFADDHLLKKVDAQNESGSKNVIKTWSRRSTIFPQMIGHTIAVHDGRRHVPVYISEDMVGHKLGEFAQTRTYRGHGKDEKKSRRK*

📊 Sample Types

Isolate 19.5%
Metagenome 78.0%
MAG 0.0%
Metatranscriptome 2.5%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 38.6%
Termitidae 19.5%
Kalotermitidae 6.4%
Formicidae 5.0%
Elmidae 4.1%
Apidae 3.2%
Drosophilidae 2.7%
Culicidae 2.3%
Blattellidae 1.8%
Tenebrionidae 1.8%
Termopsidae 1.8%
Psyllidae 1.4%
Blattidae 1.4%
Passalidae 1.4%
Cambaridae 0.9%
Cryptocercidae 0.9%
Corydiidae 0.9%
Rhinotermitidae 0.9%
Noctuidae 0.9%
Hodotermitidae 0.5%
Kiwaidae 0.5%
Daphniidae 0.5%
Curculionidae 0.5%
Stratiomyidae 0.5%
Nephropidae 0.5%
Nyctiboridae 0.5%
Harpacticidae 0.5%
Aphididae 0.5%

🌳 Taxonomy

Archaea 0
Bacteria 545
Eukaryota 0
Viruses 0
Unclassified 95

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2821322763 Unclassified Actinobacteria Cu122P5bin19 Isolate Unclassified
2 2864948220 Elizabethkingia anophelis S00205 Isolate Elmidae
3 2785510743 Apibacter sp. ESL0404 Isolate Apidae
4 2820364642 Unclassified Firmicutes Nt197P3bin107 Isolate Unclassified
5 2820385248 Unclassified Firmicutes Nt197P1bin19 Isolate Unclassified
6 2820479655 Unclassified Firmicutes Lab288P1bin77 Isolate Unclassified
7 2820487239 Unclassified Firmicutes Lab288P1bin71 Isolate Unclassified
8 2820492969 Unclassified Firmicutes Lab288P1bin6 Isolate Unclassified
9 2820539610 Unclassified Firmicutes Lab288P1bin136 Isolate Unclassified
10 2820673891 Unclassified Firmicutes Co191P3bin18 Isolate Unclassified
11 2820676843 Unclassified Firmicutes Co191P3bin17 Isolate Unclassified
12 2820713307 Unclassified Firmicutes Co191P1bin2 Isolate Unclassified
13 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
14 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
15 650716011 Blattabacterium sp. Bge Isolate Blattellidae
16 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
17 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
18 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
19 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
20 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
21 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
22 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
23 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
24 3002002726 Blattabacterium cuenoti PARATEMsp Isolate Blattellidae
25 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
26 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
27 3300007901 Neotropical army ants gut microbial communities from Monteverde, Costa Rica - Eciton burchellii Gut microbial communities of Eciton burchellii Metagenome Formicidae
28 8114076984 Elizabethkingia anophelis R26 Isolate Culicidae
29 2832343623 Apibacter adventoris wkB180 Isolate Apidae
30 2864788197 Elizabethkingia anophelis S00027 Isolate Elmidae
31 2864822740 Chryseobacterium shigense S00064 Isolate Elmidae
32 2882250448 Bizionia sp. APA-3 Isolate
33 2820227065 Unclassified Firmicutes Th196P4bin44 Isolate Unclassified
34 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
35 2820435670 Unclassified Firmicutes Lab288P3bin217 Isolate Unclassified
36 2820495292 Unclassified Firmicutes Lab288P1bin59 Isolate Unclassified
37 2820602899 Unclassified Firmicutes Emb289P1bin51 Isolate Unclassified
38 2820698910 Unclassified Firmicutes Co191P1bin64 Isolate Unclassified
39 2820709481 Unclassified Firmicutes Co191P1bin30 Isolate Unclassified
40 2773857880 Candidatus Profftella armatura YCPA Isolate Psyllidae
41 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
42 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
43 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
44 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
45 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
46 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
47 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
48 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
49 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
50 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
51 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
52 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
53 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
54 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
55 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
56 2921902974 Chryseobacterium sp. cx-624 Isolate Cambaridae
57 2958471994 Flavobacterium sp. xlx-221 Isolate Cambaridae
58 2820309449 Unclassified Firmicutes Th196P1bin10 Isolate Unclassified
59 2820347164 Unclassified Firmicutes Nt197P3bin58 Isolate Unclassified
60 2820380671 Unclassified Firmicutes Nt197P1bin4 Isolate Unclassified
61 2820432912 Unclassified Firmicutes Lab288P3bin219 Isolate Unclassified
62 2820439761 Unclassified Firmicutes Lab288P3bin203 Isolate Unclassified
63 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
64 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
65 2820547636 Unclassified Firmicutes Lab288P1bin10 Isolate Unclassified
66 2820565217 Unclassified Firmicutes Emb289P3bin51 Isolate Unclassified
67 2820598593 Unclassified Firmicutes Emb289P1bin53 Isolate Unclassified
68 2820607737 Unclassified Firmicutes Emb289P1bin48 Isolate Unclassified
69 2820663833 Unclassified Firmicutes Co191P3bin41 Isolate Unclassified
70 2511231112 Blattabacterium punctulatus Cpu Isolate Cryptocercidae
71 2576861450 Candidatus Hepatoplasma crinochetorum Av Isolate Unclassified
72 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
73 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
74 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
75 3002003370 Blattabacterium cuenoti THEREAreg Isolate Corydiidae
76 3002005207 Blattabacterium cuenoti MELANOZsp Isolate Blattidae
77 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
78 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
79 3300007733 Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean Metagenome
80 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
81 3300013007 Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts Metagenome Kiwaidae
82 3300021228 Termite gut microbial communities from nest - French Guiana - 23-5 mRNA SA Metatranscriptome Termitidae
83 3300021231 Termite gut microbial communities from nest - French Guiana - 10-1 mRNA SA Metatranscriptome Termitidae
84 3300023282 Termite gut microbial communities from Aparatermes sp. nest - French Guiana - 29-3 mRNA Metatranscriptome Termitidae
85 3300026558 Army ant gut microbial communities from Labidus praedator, Monteverde, Costa Rica - colony MVLprae1 Metagenome Formicidae
86 2864831662 Chryseobacterium sediminis S00068 Isolate Elmidae
87 2881902429 Companilactobacillus metriopterae JCM 31635 Isolate Unclassified
88 2894649344 Allomuricauda alvinocaridis SCR12 Isolate Unclassified
89 2904728850 Flavobacterium sp. xlx-214 Isolate
90 2811995047 Flavobacterium succinicans DD5b Isolate Daphniidae
91 2820018428 Unclassified Spirochaetes Nt197P3bin33 Isolate Unclassified
92 2820238527 Unclassified Firmicutes Th196P3bin90 Isolate Unclassified
93 2820350530 Unclassified Firmicutes Nt197P3bin37 Isolate Unclassified
94 2820481688 Unclassified Firmicutes Lab288P1bin76 Isolate Unclassified
95 2820490862 Unclassified Firmicutes Lab288P1bin64 Isolate Unclassified
96 2820507989 Unclassified Firmicutes Lab288P1bin41 Isolate Unclassified
97 2820537337 Unclassified Firmicutes Lab288P1bin137 Isolate Unclassified
98 2820623020 Unclassified Firmicutes Emb289P1bin126 Isolate Unclassified
99 2820685979 Unclassified Firmicutes Co191P1bin81 Isolate Unclassified
100 2820696217 Unclassified Firmicutes Co191P1bin66 Isolate Unclassified
101 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
102 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
103 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
104 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
105 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
106 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
107 8020009074 Elizabethkingia anophelis MSU001 Isolate Culicidae
108 646311912 Blattabacterium sp. BPLAN Isolate Blattidae
109 8002304686 Apilactobacillus kunkeei UASWS1867-NN5 Isolate Apidae
110 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
111 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
112 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
113 3002033046 Blattabacterium cuenoti ANALLAmet Isolate Blattellidae
114 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
115 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
116 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
117 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
118 3300028918 Ant gut bacterial community from Dolichoderus sp. 2-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC085 Metagenome Formicidae
119 2820803007 Unclassified Actinobacteria Th196P3bin61 Isolate Unclassified
120 2820917597 Unclassified Actinobacteria Emb289P3bin57 Isolate Unclassified
121 2864923010 Elizabethkingia anophelis S00177 Isolate Elmidae
122 2899132286 Myroides albus BIT-d1 Isolate Tenebrionidae
123 2940228231 Anaerovoracaceae bacterium PM5-7 Isolate Blattidae
124 2044078006 Dendroctonus frontalis bacterial communities from Mississippi, USA Metagenome Curculionidae
125 2558860143 Apilactobacillus kunkeei EFB6 Isolate Apidae
126 2820185449 Unclassified Planctomycetes Lab288P3bin146 Isolate Unclassified
127 2820303403 Unclassified Firmicutes Th196P1bin2 Isolate Unclassified
128 2820371985 Unclassified Firmicutes Nt197P3bin100 Isolate Unclassified
129 2820398208 Unclassified Firmicutes Nc150P1bin1 Isolate Unclassified
130 2820499546 Unclassified Firmicutes Lab288P1bin54 Isolate Unclassified
131 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
132 2820541116 Unclassified Firmicutes Lab288P1bin109 Isolate Unclassified
133 2820581541 Unclassified Firmicutes Emb289P3bin127 Isolate Unclassified
134 2820644600 Unclassified Firmicutes Cu122P5bin39 Isolate Unclassified
135 2820654856 Unclassified Firmicutes Cu122P1bin2 Isolate Unclassified
136 2820671341 Unclassified Firmicutes Co191P3bin20 Isolate Unclassified
137 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
138 3300060772 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_HDPE_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
139 8030343600 Proteiniborus sp. MB09-C3 Isolate Stratiomyidae
140 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
141 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
142 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
143 3002004002 Blattabacterium cuenoti EUPOLsin Isolate Corydiidae
144 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
145 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
146 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
147 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
148 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
149 3300008519 Neotropical army ants gut microbial communities from Monteverde, Costa Rica - Neivamyrmex summichrasti Gut microbial communities of Neivamyrmex summichrasti Metagenome Formicidae
150 3300009460 Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov Metagenome
151 3300022820 Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA Metatranscriptome Termitidae
152 2820947865 Unclassified Acidobacteria Nt197P3bin133 Isolate Unclassified
153 2838772460 Aquimarina sp. I32.4 Isolate Nephropidae
154 2035265002 Agrotis sp. gut microbial communities from Texas A and M University, USA Metagenome Noctuidae
155 2561511170 Blattabacterium sp. (Blatta orientalis) Tarazona Isolate Unclassified
156 2563366575 Spiroplasma apis B31 Isolate Unclassified
157 2565956547 Candidatus Profftella armatura Isolate Psyllidae
158 2799112231 Apibacter sp. ESL0432 Isolate Unclassified
159 2820196379 Unclassified Planctomycetes Emb289P3bin158 Isolate Unclassified
160 2820200053 Unclassified Planctomycetes Cu122P5bin40 Isolate Unclassified
161 2820369699 Unclassified Firmicutes Nt197P3bin103 Isolate Unclassified
162 2820375548 Unclassified Firmicutes Nt197P1bin8 Isolate Unclassified
163 2820408893 Unclassified Firmicutes Lab288P4bin80 Isolate Unclassified
164 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
165 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
166 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
167 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
168 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
169 3002023891 Blattabacterium cuenoti MEGALOsp Isolate Nyctiboridae
170 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
171 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
172 3300003097 Cutworm gut microbial communities from Hangzhou, China Metagenome Noctuidae
173 3300007058 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 3 gut Metagenome Drosophilidae
174 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
175 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
176 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
177 3300021239 Termite gut microbial communities from nest from French Guiana - FG16_17_4 mRNA SA Metatranscriptome
178 3300026175 Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 Metagenome Formicidae
179 3300026559 Army ant gut microbial communities from Eciton burchelli, Santa Rosa, Costa Rica - colony SREbp2 Metagenome Formicidae
180 2820893114 Unclassified Actinobacteria Lab288P1bin125 Isolate Unclassified
181 2832298047 Apibacter sp. wkB309 Isolate Apidae
182 2833043393 Blattabacterium clevelandi CCLhc Isolate Cryptocercidae
183 2847090942 Elizabethkingia anophelis Ag1 Isolate Culicidae
184 2864882932 Chryseobacterium shingense S00136 Isolate Elmidae
185 2864891731 Chryseobacterium defluvii S00151 Isolate Elmidae
186 2021593000 Sample 264 Metagenome Harpacticidae
187 2209111014 Host-associated microbial communities from Diaphorina citri thoracic segments in Florida, USA - ACP Metagenome Psyllidae
188 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
189 2687453786 Chryseobacterium culicis DSM 23031 Isolate Unclassified
190 2820525019 Unclassified Firmicutes Lab288P1bin2 Isolate Unclassified
191 2820630457 Unclassified Firmicutes Emb289P1bin119 Isolate Unclassified
192 2675903377 Apilactobacillus kunkeei AR114 Isolate Unclassified
193 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
194 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
195 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
196 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
197 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
198 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
199 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
200 3002008998 Blattabacterium cuenoti PARCOBvir Isolate Blattellidae
201 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
202 3300005307 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 1 gut Metagenome Drosophilidae
203 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
204 3300022232 Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA Metatranscriptome Termitidae
205 2820942695 Unclassified Actinobacteria Cu122P5bin37 Isolate Unclassified
206 2832372155 Apibacter adventoris wkB301 Isolate Apidae
207 2864878056 Flavobacterium notoginsengisoli S00128 Isolate Elmidae
208 2864886855 Flavobacterium nitrogenifigens S00142 Isolate Elmidae
209 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
210 2529292732 Elizabethkingia anophelis R26 Isolate Culicidae
211 2820277137 Unclassified Firmicutes Th196P3bin150 Isolate Unclassified
212 2820327087 Unclassified Firmicutes Nt197P3bin79 Isolate Unclassified
213 2820378768 Unclassified Firmicutes Nt197P1bin7 Isolate Unclassified
214 2820382897 Unclassified Firmicutes Nt197P1bin3 Isolate Unclassified
215 2820401926 Unclassified Firmicutes Mp193P1bin2 Isolate Unclassified
216 2820459456 Unclassified Firmicutes Lab288P3bin148 Isolate Unclassified
217 2820513949 Unclassified Firmicutes Lab288P1bin39 Isolate Unclassified
218 2820528380 Unclassified Firmicutes Lab288P1bin143 Isolate Unclassified
219 2820535361 Unclassified Firmicutes Lab288P1bin14 Isolate Unclassified
220 2820627938 Unclassified Firmicutes Emb289P1bin122 Isolate Unclassified
221 2820693137 Unclassified Firmicutes Co191P1bin70 Isolate Unclassified
222 2998929858 Bacteroidetes endosymbiont of Geopemphigus sp. GspS2-BC2016 Isolate Aphididae
223 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
224 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
225 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
226 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
227 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
228 3300021229 Termite gut microbial communities from nest from French Guiana - 12-5 mRNA SA Metatranscriptome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_099438 3300042611 Bacteria 3727
2 Ga0466733_091171 3300042659 Bacteria 20195
3 Ga0466733_167004 3300042659 Bacteria 3067
4 Ga0562376_2522 3300056857 Bacteria 21571
5 Ga0466715_339223 3300042616 Bacteria 59419
6 Ga0466715_416878 3300042616 Bacteria 48123
7 Ga0466718_094987 3300042617 Unclassified 1492
8 Ga0466729_088310 3300042621 Bacteria 2236
9 Ga0466729_309738 3300042621 Bacteria 19337
10 Ga0466735_009589 3300042624 Bacteria 3533
11 Ga0466735_049370 3300042624 Unclassified 2254
12 Ga0466702_024756 3300042635 Bacteria 8312
13 Ga0466704_187124 3300042643 Bacteria 12261
14 Ga0466724_48971 3300042649 Bacteria 2121
15 Ga0466708_367339 3300042652 Bacteria 21747
16 Ga0466727_034751 3300042655 Bacteria 11324
17 Ga0123357_10302317 3300009784 Unclassified 1614
18 Ga0123355_10000168 3300009826 Bacteria 79476
19 Ga0123355_10046667 3300009826 Bacteria 7045
20 Ga0123355_10164330 3300009826 Bacteria 3335
21 Ga0123355_10193262 3300009826 Bacteria 2992
22 Ga0123355_10540611 3300009826 Unclassified 1414
23 Ga0123355_10642665 3300009826 Bacteria 1241
24 Ga0123355_10643464 3300009826 Unclassified 1240
25 Ga0123355_10936189 3300009826 Unclassified 933
26 Ga0123355_11001206 3300009826 Bacteria 887
27 Ga0123355_11303536 3300009826 Unclassified 728
28 Ga0123355_11377355 3300009826 Bacteria 700
29 Ga0123355_11493324 3300009826 Unclassified 660
30 Ga0123355_11825150 3300009826 Unclassified 572
31 Ga0123356_10140671 3300010049 Bacteria 2380
32 Ga0123356_11486265 3300010049 Bacteria 835
33 Ga0123356_12370516 3300010049 Bacteria 664
34 Ga0123356_13537391 3300010049 Bacteria 541
35 Ga0123356_13604497 3300010049 Bacteria 536
36 Ga0123353_10119969 3300010167 Bacteria 4229
37 Ga0123353_10489041 3300010167 Bacteria 1797
38 Ga0123353_10642277 3300010167 Bacteria 1505
39 Ga0123353_10688625 3300010167 Bacteria 1438
40 Ga0123353_12116578 3300010167 Bacteria 684
41 Ga0123353_12157893 3300010167 Bacteria 676
42 Ga0123353_12550807 3300010167 Bacteria 606
43 Ga0123353_13304627 3300010167 Bacteria 514
44 Ga0123354_10012254 3300010882 Bacteria 13287
45 Ga0160442_100065 3300012806 Bacteria 144556
46 Ga0255809_1004350 3300022820 Bacteria 3655
47 Ga0415639_000644 3300038395 Bacteria 27607
48 Ga0415639_057465 3300038395 Unclassified 1362
49 Ga0415639_225963 3300038395 Bacteria 1516
50 Ga0466657_208141 3300042582 Bacteria 1100
51 Ga0466693_042472 3300042592 Bacteria 1665
52 Ga0466693_158043 3300042592 Bacteria 1863
53 Ga0466693_189648 3300042592 Bacteria 16531
54 Ga0466696_337355 3300042596 Bacteria 1715
55 Ga0466701_038229 3300042598 Bacteria 61272
56 Ga0466706_130476 3300042599 Bacteria 1690
57 Ga0466714_003503 3300042603 Bacteria 8470
58 Ga0466714_025045 3300042603 Bacteria 5162
59 Ga0466716_136299 3300042605 Bacteria 1152
60 Ga0466719_203918 3300042606 Bacteria 15671
61 TM1208_contig03480 2021593000 Bacteria 1644
62 2227532921 2225789004 Unclassified 627
63 IMNBL1DRAFT_c0007028 3300000062 Bacteria 6005
64 IMNBL1DRAFT_c0034574 3300000062 Bacteria 1796
65 JGI24695J34938_10000025 3300002450 Bacteria 108086
66 JGI24695J34938_10141812 3300002450 Bacteria 982
67 JGI24695J34938_10568966 3300002450 Bacteria 525
68 JGI24702J35022_10146068 3300002462 Bacteria 1323
69 JGI24702J35022_10651174 3300002462 Unclassified 653
70 JGI24703J35330_11748269 3300002501 Bacteria 12890
71 Ga0068305_10002308 3300005083 Bacteria 45236
72 Ga0072941_1007162 3300005201 Bacteria 33370
73 Ga0072941_1120372 3300005201 Bacteria 5652
74 Ga0072941_1451070 3300005201 Bacteria 2058
75 Ga0102737_1000052 3300007142 Bacteria 34662
76 Ga0466697_165071 3300042611 Bacteria 1232
77 Ga0466711_257614 3300042615 Bacteria 3272
78 Ga0466715_183088 3300042616 Bacteria 24090
79 Ga0466723_315712 3300042618 Bacteria 6485
80 Ga0466735_164714 3300042624 Bacteria 1262
81 Ga0466703_144605 3300042636 Bacteria 9715
82 Ga0466709_168921 3300042648 Unclassified 1129
83 Ga0466709_346366 3300042648 Bacteria 1769
84 Ga0466725_082702 3300042654 Bacteria 32093
85 Ga0466725_318091 3300042654 Bacteria 2764
86 Ga0466725_346621 3300042654 Bacteria 12162
87 Ga0466725_392948 3300042654 Bacteria 12450
88 Ga0123357_10476452 3300009784 Unclassified 1059
89 Ga0123355_10020764 3300009826 Bacteria 10499
90 Ga0123355_10080589 3300009826 Bacteria 5197
91 Ga0123355_10276834 3300009826 Bacteria 2323
92 Ga0123355_10304217 3300009826 Unclassified 2169
93 Ga0123355_10324625 3300009826 Bacteria 2069
94 Ga0123355_10370514 3300009826 Unclassified 1876
95 Ga0123355_10419129 3300009826 Bacteria 1712
96 Ga0123355_10439523 3300009826 Bacteria 1653
97 Ga0123355_10442387 3300009826 Bacteria 1645
98 Ga0123355_10455081 3300009826 Bacteria 1610
99 Ga0123355_10686063 3300009826 Bacteria 1182
100 Ga0123355_11598925 3300009826 Unclassified 628
101 Ga0123355_11792995 3300009826 Unclassified 579
102 Ga0123356_11879125 3300010049 Unclassified 745
103 Ga0123356_12814797 3300010049 Bacteria 609
104 Ga0123356_13000028 3300010049 Bacteria 589
105 Ga0123356_13390291 3300010049 Bacteria 553
106 Ga0123353_10071905 3300010167 Bacteria 5559
107 Ga0123353_10819757 3300010167 Unclassified 1281
108 Ga0123353_12844151 3300010167 Unclassified 566
109 Ga0123354_10813799 3300010882 Bacteria 627
110 Ga0223690_1012070 3300021228 Bacteria 511
111 Ga0233288_1013489 3300022232 Bacteria 667
112 Ga0255809_1032884 3300022820 Unclassified 1266
113 Ga0466693_061628 3300042592 Bacteria 4586
114 Ga0466694_299149 3300042594 Bacteria 2905
115 Ga0466695_352172 3300042595 Bacteria 4668
116 Ga0466699_050618 3300042597 Bacteria 2232
117 Ga0466701_053809 3300042598 Unclassified 6003
118 Ga0466700_201003 3300042600 Bacteria 1067
119 Ga0466707_154096 3300042601 Bacteria 1058
120 Ga0466707_288166 3300042601 Bacteria 2865
121 Ga0466714_006478 3300042603 Unclassified 1398
122 Ga0466717_031242 3300042604 Unclassified 1395
123 Ga0466719_032866 3300042606 Bacteria 15467
124 2217977604 2209111014 Bacteria 3106
125 IMNBL1DRAFT_c0000219 3300000062 Bacteria 50195
126 IMNBL1DRAFT_c0000272 3300000062 Bacteria 45809
127 IMNBL1DRAFT_c0008644 3300000062 Bacteria 5158
128 AustNasuHG_c1011163 3300000089 Bacteria 3117
129 JGI24695J34938_10206355 3300002450 Bacteria 820
130 JGI24703J35330_11355221 3300002501 Bacteria 906
131 JGI24703J35330_11703009 3300002501 Bacteria 2054
132 JGI24705J35276_12011560 3300002504 Bacteria 862
133 JGI24696J40584_12958136 3300002834 Bacteria 3915
134 Ga0072941_1148988 3300005201 Bacteria 3629
135 Ga0103265_1000086 3300007068 Bacteria 18456
136 Ga0104045_1006444 3300007085 Unclassified 4518
137 Ga0127649_100060 3300009460 Bacteria 50841
138 Ga0466705_271435 3300042612 Bacteria 3563
139 Ga0466733_177328 3300042659 Bacteria 1748
140 Ga0590796_09464 3300060772 Bacteria 845
141 Ga0466711_345094 3300042615 Bacteria 14257
142 Ga0466715_441071 3300042616 Bacteria 4802
143 Ga0466715_548367 3300042616 Bacteria 1040
144 Ga0466715_643559 3300042616 Bacteria 6633
145 Ga0466718_088859 3300042617 Bacteria 1192
146 Ga0466718_151251 3300042617 Unclassified 2033
147 Ga0466723_043688 3300042618 Bacteria 3654
148 Ga0466726_139249 3300042619 Unclassified 1481
149 Ga0466726_252375 3300042619 Bacteria 2207
150 Ga0466728_063255 3300042620 Bacteria 5662
151 Ga0466729_287045 3300042621 Bacteria 99069
152 Ga0466735_160277 3300042624 Unclassified 1139
153 Ga0466702_244501 3300042635 Unclassified 1008
154 Ga0466704_476830 3300042643 Bacteria 23263
155 Ga0466724_52014 3300042649 Bacteria 5428
156 Ga0466724_59158 3300042649 Bacteria 434991
157 Ga0466708_205008 3300042652 Bacteria 28180
158 Ga0466708_237364 3300042652 Bacteria 11901
159 Ga0123357_10385814 3300009784 Bacteria 1294
160 Ga0123355_10006100 3300009826 Bacteria 17776
161 Ga0123355_10102904 3300009826 Bacteria 4490
162 Ga0123355_10276050 3300009826 Bacteria 2327
163 Ga0123355_10283291 3300009826 Bacteria 2285
164 Ga0123355_10298252 3300009826 Bacteria 2201
165 Ga0123355_10383010 3300009826 Bacteria 1830
166 Ga0123355_10403570 3300009826 Bacteria 1761
167 Ga0123355_10479034 3300009826 Unclassified 1550
168 Ga0123355_10755664 3300009826 Bacteria 1098
169 Ga0123355_11424664 3300009826 Bacteria 683
170 Ga0123355_11558632 3300009826 Bacteria 640
171 Ga0123356_10226888 3300010049 Bacteria 1929
172 Ga0123356_10434404 3300010049 Bacteria 1458
173 Ga0123356_10774028 3300010049 Bacteria 1130
174 Ga0123353_10015659 3300010167 Bacteria 11032
175 Ga0123353_10023187 3300010167 Bacteria 9391
176 Ga0123353_10267288 3300010167 Bacteria 2637
177 Ga0123353_10294897 3300010167 Bacteria 2480
178 Ga0123353_10389104 3300010167 Bacteria 2081
179 Ga0123353_10933352 3300010167 Bacteria 1176
180 Ga0123353_11463343 3300010167 Bacteria 873
181 Ga0123353_12079764 3300010167 Unclassified 692
182 Ga0123353_13321354 3300010167 Unclassified 513
183 Ga0223677_1036789 3300021239 Bacteria 862
184 Ga0309901_1106912 3300028918 Bacteria 543
185 Ga0415639_029333 3300038395 Unclassified 1427
186 Ga0466693_117130 3300042592 Bacteria 5911
187 Ga0466693_167405 3300042592 Bacteria 2659
188 Ga0466693_212372 3300042592 Bacteria 6840
189 Ga0466699_138149 3300042597 Bacteria 3089
190 Ga0466706_047001 3300042599 Bacteria 29829
191 Ga0466706_191347 3300042599 Bacteria 11530
192 Ga0466713_029225 3300042602 Bacteria 54762
193 Ga0466713_112521 3300042602 Bacteria 2522
194 Ga0466719_282135 3300042606 Unclassified 1495
195 Ga0466722_186683 3300042609 Bacteria 2796
196 2227262202 2225789004 Bacteria 1296
197 2227542038 2225789004 Unclassified 602
198 JGI24695J34938_10074165 3300002450 Bacteria 1416
199 JGI24703J35330_11748024 3300002501 Unclassified 9993
200 JGI24703J35330_11748775 3300002501 Bacteria 33848
201 Ga0072941_1008137 3300005201 Bacteria 12136
202 Ga0072941_1102374 3300005201 Bacteria 13675
203 Ga0072941_1307270 3300005201 Bacteria 1495
204 Ga0105005_1101387 3300007505 Unclassified 2292
205 Ga0105524_109208 3300007733 Bacteria 1525
206 Ga0111035_123948 3300007901 Unclassified 554
207 Ga0466711_163992 3300042615 Bacteria 16015
208 Ga0466723_063787 3300042618 Bacteria 1664
209 Ga0466734_028330 3300042623 Bacteria 2318
210 Ga0466734_148627 3300042623 Bacteria 1089
211 Ga0466735_122062 3300042624 Bacteria 1274
212 Ga0466735_163382 3300042624 Bacteria 1713
213 Ga0466702_037808 3300042635 Bacteria 1607
214 Ga0466704_009857 3300042643 Bacteria 4106
215 Ga0466708_351496 3300042652 Bacteria 8696
216 Ga0466708_403861 3300042652 Bacteria 6561
217 Ga0466725_222586 3300042654 Unclassified 2240
218 Ga0466727_076044 3300042655 Bacteria 7582
219 Ga0123355_10000566 3300009826 Bacteria 49780
220 Ga0123355_10001214 3300009826 Bacteria 35876
221 Ga0123355_10078645 3300009826 Unclassified 5269
222 Ga0123355_10131908 3300009826 Bacteria 3848
223 Ga0123355_10132502 3300009826 Bacteria 3836
224 Ga0123355_10184901 3300009826 Bacteria 3084
225 Ga0123355_10226405 3300009826 Unclassified 2679
226 Ga0123355_10430605 3300009826 Bacteria 1678
227 Ga0123356_11683329 3300010049 Unclassified 787
228 Ga0123356_12815030 3300010049 Unclassified 609
229 Ga0123356_13042760 3300010049 Unclassified 585
230 Ga0123353_10000953 3300010167 Bacteria 35371
231 Ga0123353_10344867 3300010167 Bacteria 2248
232 Ga0123353_10831335 3300010167 Unclassified 1269
233 Ga0123353_10935511 3300010167 Unclassified 1175
234 Ga0123353_11439141 3300010167 Bacteria 883
235 Ga0123353_13212798 3300010167 Bacteria 523
236 Ga0157631_125930 3300013007 Bacteria 613
237 Ga0233288_1033841 3300022232 Bacteria 1679
238 Ga0233288_1083636 3300022232 Bacteria 644
239 Ga0255808_1022765 3300023282 Bacteria 776
240 Ga0415639_009611 3300038395 Bacteria 4413
241 Ga0415639_097241 3300038395 Bacteria 1122
242 Ga0466690_017258 3300042590 Bacteria 20347
243 Ga0466690_056956 3300042590 Bacteria 1846
244 Ga0466690_269501 3300042590 Bacteria 1222
245 Ga0466693_148235 3300042592 Bacteria 1000
246 Ga0466693_150064 3300042592 Bacteria 1435
247 Ga0466693_280489 3300042592 Bacteria 6424
248 Ga0466691_199512 3300042593 Bacteria 13089
249 Ga0466694_075865 3300042594 Bacteria 2545
250 Ga0466694_197142 3300042594 Bacteria 2973
251 Ga0466696_188687 3300042596 Unclassified 1322
252 Ga0466706_005767 3300042599 Bacteria 1477
253 Ga0466706_135974 3300042599 Bacteria 1820
254 Ga0466700_128959 3300042600 Bacteria 1146
255 Ga0466713_107471 3300042602 Bacteria 9305
256 Ga0466717_014974 3300042604 Bacteria 2375
257 Ga0466717_021947 3300042604 Bacteria 25100
258 Ga0466717_157154 3300042604 Unclassified 1099
259 Ga0466716_077310 3300042605 Bacteria 14234
260 Ga0466721_171686 3300042608 Bacteria 1111
261 Ga0466721_373336 3300042608 Bacteria 4345
262 SPBB_GA1I6PA02GRB0Q 2044078006 Bacteria 534
263 2227507959 2225789004 Bacteria 65570
264 IMNBL1DRAFT_c0003455 3300000062 Bacteria 10150
265 IMNBL1DRAFT_c0004808 3300000062 Bacteria 7967
266 IMNBL1DRAFT_c0006760 3300000062 Bacteria 6196
267 JGI24703J35330_11677731 3300002501 Bacteria 1782
268 JGI24705J35276_11601933 3300002504 Bacteria 592
269 Ga0072941_1186389 3300005201 Bacteria 7095
270 Ga0104043_1095596 3300007058 Bacteria 939
271 Ga0102739_1000034 3300007095 Bacteria 41545
272 Ga0104048_1005902 3300007143 Bacteria 3006
273 Ga0105524_101637 3300007733 Bacteria 15214
274 Ga0466697_066199 3300042611 Bacteria 4152
275 Ga0466705_279905 3300042612 Bacteria 2633
276 Ga0466705_340721 3300042612 Bacteria 18791
277 Ga0466733_160009 3300042659 Bacteria 3889
278 Ga0466710_317369 3300042613 Bacteria 2063
279 Ga0466711_139501 3300042615 Bacteria 14201
280 Ga0466715_472271 3300042616 Bacteria 12499
281 Ga0466718_134432 3300042617 Unclassified 1129
282 Ga0466726_380315 3300042619 Bacteria 17436
283 Ga0466735_181243 3300042624 Bacteria 57199
284 Ga0466703_027809 3300042636 Bacteria 17782
285 Ga0466704_092199 3300042643 Unclassified 9127
286 Ga0466709_301551 3300042648 Unclassified 1898
287 Ga0466708_215505 3300042652 Bacteria 16232
288 Ga0466708_297325 3300042652 Bacteria 1169
289 Ga0466708_312029 3300042652 Bacteria 11363
290 Ga0466708_347179 3300042652 Unclassified 1671
291 Ga0466725_267302 3300042654 Unclassified 1135
292 Ga0466727_240143 3300042655 Bacteria 1494
293 Ga0123355_10000469 3300009826 Bacteria 53443
294 Ga0123355_10001028 3300009826 Bacteria 38728
295 Ga0123355_10002864 3300009826 Bacteria 24503
296 Ga0123355_10227896 3300009826 Bacteria 2667
297 Ga0123355_10302559 3300009826 Bacteria 2178
298 Ga0123355_10377250 3300009826 Bacteria 1852
299 Ga0123355_10508830 3300009826 Unclassified 1481
300 Ga0123355_10909937 3300009826 Bacteria 954
301 Ga0123355_11445414 3300009826 Unclassified 675
302 Ga0123356_10034890 3300010049 Bacteria 4701
303 Ga0123356_10920138 3300010049 Unclassified 1046
304 Ga0123356_11935686 3300010049 Unclassified 734
305 Ga0123353_10021067 3300010167 Bacteria 9769
306 Ga0123353_10246843 3300010167 Bacteria 2769
307 Ga0123353_10660051 3300010167 Bacteria 1478
308 Ga0123354_10672909 3300010882 Bacteria 732
309 Ga0223685_1031656 3300021229 Bacteria 613
310 Ga0223682_1001582 3300021231 Bacteria 1746
311 Ga0255572_1000839 3300026175 Bacteria 31625
312 Ga0255576_1000150 3300026558 Bacteria 47989
313 Ga0415639_163325 3300038395 Bacteria 1567
314 Ga0466690_221214 3300042590 Unclassified 4889
315 Ga0466693_291245 3300042592 Bacteria 1304
316 Ga0466693_380074 3300042592 Bacteria 1894
317 Ga0466696_079830 3300042596 Bacteria 1620
318 Ga0466699_231547 3300042597 Bacteria 1380
319 Ga0466701_085896 3300042598 Bacteria 1787
320 Ga0466700_316411 3300042600 Bacteria 1303
321 Ga0466707_086009 3300042601 Bacteria 1887
322 Ga0466719_512041 3300042606 Bacteria 2794
323 Ga0466720_146818 3300042607 Unclassified 6563
324 CwormDRAF_NODE_7141_len_1133_cov_224_493378 2035265002 Unclassified 1163
325 2227624636 2225789004 Bacteria 11576
326 IMNBL1DRAFT_c0112686 3300000062 Unclassified 721
327 IMNBL1DRAFT_c0131124 3300000062 Bacteria 653
328 HBC_ctgsDRAFT_1000005 3300000333 Bacteria 62596
329 JGI24695J34938_10000103 3300002450 Bacteria 74289
330 JGI24695J34938_10000403 3300002450 Bacteria 42148
331 JGI24702J35022_10038156 3300002462 Bacteria 2565
332 Meta3P_1002969 3300002464 Bacteria 8316
333 JGI24700J35501_10930659 3300002508 Bacteria 17918
334 JGI24696J40584_12756392 3300002834 Bacteria 801
335 Ga0052191_103649 3300003097 Bacteria 1163
336 Ga0068302_10113221 3300005071 Unclassified 1492
337 Ga0074308_1116206 3300005307 Unclassified 1194
338 Ga0074263_120597 3300005485 Unclassified 847
339 Ga0102735_1000172 3300007080 Bacteria 22744
340 Ga0466733_017994 3300042659 Unclassified 1326
341 Ga0466733_162242 3300042659 Bacteria 3158
342 Ga0466711_008826 3300042615 Unclassified 1986
343 Ga0466711_184685 3300042615 Bacteria 9250
344 Ga0466723_031716 3300042618 Bacteria 3535
345 Ga0466723_242668 3300042618 Bacteria 2078
346 Ga0466726_063504 3300042619 Bacteria 16884
347 Ga0466702_212870 3300042635 Bacteria 1290
348 Ga0466704_096437 3300042643 Bacteria 55959
349 Ga0123357_10708143 3300009784 Bacteria 718
350 Ga0123355_10000555 3300009826 Bacteria 50033
351 Ga0123355_10000733 3300009826 Bacteria 44688
352 Ga0123355_10002132 3300009826 Bacteria 27941
353 Ga0123355_10013785 3300009826 Bacteria 12596
354 Ga0123355_10226639 3300009826 Bacteria 2677
355 Ga0123355_10274349 3300009826 Bacteria 2338
356 Ga0123355_10283068 3300009826 Unclassified 2286
357 Ga0123355_10289991 3300009826 Bacteria 2247
358 Ga0123355_10310143 3300009826 Bacteria 2140
359 Ga0123355_10374570 3300009826 Unclassified 1861
360 Ga0123355_10617598 3300009826 Unclassified 1279
361 Ga0123355_11125019 3300009826 Bacteria 813
362 Ga0123355_11165160 3300009826 Bacteria 792
363 Ga0123355_11310901 3300009826 Unclassified 725
364 Ga0123355_11668075 3300009826 Bacteria 609
365 Ga0123356_10001853 3300010049 Bacteria 22938
366 Ga0123356_11038970 3300010049 Bacteria 989
367 Ga0123356_13124166 3300010049 Bacteria 577
368 Ga0123353_10115290 3300010167 Bacteria 4324
369 Ga0123353_10765133 3300010167 Bacteria 1341
370 Ga0123353_12299789 3300010167 Bacteria 648
371 Ga0123354_10549139 3300010882 Bacteria 872
372 Ga0123354_10776279 3300010882 Bacteria 651
373 Ga0255809_1024978 3300022820 Unclassified 939
374 Ga0255809_1036659 3300022820 Bacteria 1111
375 Ga0415639_108911 3300038395 Bacteria 1170
376 Ga0466693_342291 3300042592 Bacteria 1104
377 Ga0466706_029003 3300042599 Bacteria 3990
378 Ga0466706_241347 3300042599 Bacteria 14034
379 Ga0466714_041024 3300042603 Bacteria 3905
380 Ga0466714_159415 3300042603 Bacteria 1088
381 Ga0466720_040299 3300042607 Bacteria 13637
382 Ga0466722_187845 3300042609 Bacteria 2497
383 2227073312 2225789003 Bacteria 2462
384 JGI24695J34938_10059194 3300002450 Unclassified 1640
385 JGI24702J35022_10000691 3300002462 Bacteria 20609
386 JGI24702J35022_10017689 3300002462 Bacteria 3892
387 JGI24703J35330_11417276 3300002501 Bacteria 983
388 JGI24705J35276_12234599 3300002504 Bacteria 5658
389 JGI24700J35501_10924065 3300002508 Bacteria 5357
390 JGI24700J35501_10929970 3300002508 Bacteria 10835
391 Ga0068302_10006864 3300005071 Bacteria 2932
392 Ga0072940_1290126 3300005200 Bacteria 1301
393 Ga0072941_1620131 3300005201 Bacteria 1340
394 Ga0074308_1114591 3300005307 Unclassified 1708
395 Ga0104019_1211103 3300007150 Bacteria 593
396 Ga0111035_102149 3300007901 Bacteria 22902
397 Ga0466705_077393 3300042612 Bacteria 2200
398 Ga0466705_261073 3300042612 Bacteria 35670
399 Ga0562377_0006 3300056842 Bacteria 3350072
400 Ga0466711_232284 3300042615 Bacteria 1278
401 Ga0466715_323395 3300042616 Unclassified 4935
402 Ga0466718_058191 3300042617 Bacteria 1475
403 Ga0466726_207501 3300042619 Bacteria 8201
404 Ga0466729_143979 3300042621 Unclassified 3113
405 Ga0466734_094607 3300042623 Bacteria 3218
406 Ga0466734_140778 3300042623 Bacteria 1044
407 Ga0466702_012255 3300042635 Bacteria 2735
408 Ga0466702_431281 3300042635 Bacteria 2645
409 Ga0466703_409077 3300042636 Unclassified 22726
410 Ga0466704_150483 3300042643 Bacteria 8168
411 Ga0466704_387914 3300042643 Bacteria 1097
412 Ga0466725_016860 3300042654 Unclassified 1453
413 Ga0466725_195638 3300042654 Bacteria 1542
414 Ga0466725_273211 3300042654 Bacteria 4127
415 Ga0123357_10426232 3300009784 Bacteria 1178
416 Ga0123357_10853394 3300009784 Unclassified 601
417 Ga0123355_10000164 3300009826 Bacteria 81449
418 Ga0123355_10000459 3300009826 Bacteria 53637
419 Ga0123355_10001096 3300009826 Bacteria 37400
420 Ga0123355_10106399 3300009826 Bacteria 4398
421 Ga0123355_10355432 3300009826 Bacteria 1936
422 Ga0123355_10428285 3300009826 Bacteria 1685
423 Ga0123355_10797691 3300009826 Bacteria 1054
424 Ga0123355_10973512 3300009826 Bacteria 906
425 Ga0123355_11198234 3300009826 Unclassified 775
426 Ga0123355_11324842 3300009826 Unclassified 720
427 Ga0123356_11131249 3300010049 Unclassified 951
428 Ga0123356_11604746 3300010049 Unclassified 805
429 Ga0123356_11620225 3300010049 Bacteria 801
430 Ga0123353_10000688 3300010167 Bacteria 41343
431 Ga0123353_10215963 3300010167 Bacteria 3004
432 Ga0123353_10226325 3300010167 Bacteria 2920
433 Ga0123354_10947993 3300010882 Unclassified 559
434 Ga0160440_109106 3300012815 Unclassified 887
435 Ga0255809_1005984 3300022820 Unclassified 656
436 Ga0255809_1012261 3300022820 Bacteria 1928
437 Ga0415639_088488 3300038395 Bacteria 2502
438 Ga0466657_156361 3300042582 Bacteria 1591
439 Ga0466691_201130 3300042593 Bacteria 16704
440 Ga0466694_021830 3300042594 Bacteria 15157
441 Ga0466694_175837 3300042594 Bacteria 1625
442 Ga0466696_037048 3300042596 Bacteria 24718
443 Ga0466706_011046 3300042599 Unclassified 4055
444 Ga0466700_202321 3300042600 Bacteria 13188
445 Ga0466707_011714 3300042601 Bacteria 3315
446 Ga0466707_390067 3300042601 Bacteria 18907
447 Ga0466714_111479 3300042603 Bacteria 8086
448 Ga0466714_152185 3300042603 Bacteria 1229
449 Ga0466716_215419 3300042605 Bacteria 4995
450 Ga0466721_035261 3300042608 Bacteria 1050
451 Ga0466722_005069 3300042609 Bacteria 3767
452 Ga0466722_025078 3300042609 Bacteria 1703
453 IMNBL1DRAFT_c0031286 3300000062 Bacteria 1938
454 HBC_ctgsDRAFT_1000303 3300000333 Bacteria 11267
455 JGI24698J34947_10000503 3300002449 Bacteria 18398
456 JGI24695J34938_10003848 3300002450 Bacteria 10185
457 JGI24702J35022_10013151 3300002462 Bacteria 4589
458 JGI24702J35022_10825353 3300002462 Bacteria 578
459 JGI24703J35330_11287032 3300002501 Bacteria 836
460 JGI24697J35500_11273971 3300002507 Bacteria 6293
461 Ga0104045_1004465 3300007085 Bacteria 6235
462 Ga0103268_1001722 3300007192 Bacteria 5208
463 Ga0466732_362417 3300042656 Bacteria 1722
464 Ga0466711_190663 3300042615 Bacteria 5104
465 Ga0466715_411196 3300042616 Bacteria 15845
466 Ga0466715_586248 3300042616 Bacteria 20520
467 Ga0466718_075071 3300042617 Bacteria 11142
468 Ga0466726_408314 3300042619 Bacteria 25305
469 Ga0466729_028580 3300042621 Bacteria 5717
470 Ga0466735_064739 3300042624 Bacteria 2717
471 Ga0466704_003381 3300042643 Unclassified 2244
472 Ga0466708_097473 3300042652 Bacteria 40764
473 Ga0466725_380104 3300042654 Bacteria 28941
474 Ga0466727_059120 3300042655 Bacteria 3691
475 Ga0123357_10805053 3300009784 Bacteria 635
476 Ga0123355_10003449 3300009826 Bacteria 22687
477 Ga0123355_10125205 3300009826 Bacteria 3973
478 Ga0123355_10163639 3300009826 Bacteria 3344
479 Ga0123355_10169437 3300009826 Bacteria 3268
480 Ga0123355_10373781 3300009826 Unclassified 1864
481 Ga0123355_10632181 3300009826 Unclassified 1257
482 Ga0123355_10686450 3300009826 Unclassified 1181
483 Ga0123355_10829797 3300009826 Bacteria 1023
484 Ga0123355_11123708 3300009826 Unclassified 814
485 Ga0123356_11296088 3300010049 Bacteria 892
486 Ga0123356_12201159 3300010049 Bacteria 689
487 Ga0123356_12941073 3300010049 Bacteria 595
488 Ga0123353_10119548 3300010167 Bacteria 4238
489 Ga0123353_10318247 3300010167 Bacteria 2363
490 Ga0123353_10575525 3300010167 Bacteria 1617
491 Ga0123353_11635524 3300010167 Unclassified 811
492 Ga0123353_11767077 3300010167 Bacteria 771
493 Ga0255808_1000562 3300023282 Bacteria 765
494 Ga0255572_1000024 3300026175 Bacteria 128087
495 Ga0255575_1000023 3300026559 Bacteria 88290
496 Ga0415639_117195 3300038395 Bacteria 2595
497 Ga0466690_346319 3300042590 Unclassified 4945
498 Ga0466693_023801 3300042592 Bacteria 5019
499 Ga0466693_390324 3300042592 Bacteria 1275
500 Ga0466696_210364 3300042596 Bacteria 6960
501 Ga0466696_389397 3300042596 Bacteria 2260
502 Ga0466701_024577 3300042598 Bacteria 4962
503 Ga0466701_038829 3300042598 Bacteria 2290
504 Ga0466706_113164 3300042599 Bacteria 25442
505 Ga0466713_014023 3300042602 Bacteria 32520
506 Ga0466717_208932 3300042604 Bacteria 13947
507 Ga0466719_236594 3300042606 Bacteria 21995
508 Ga0466722_173467 3300042609 Bacteria 3100
509 2227099141 2225789004 Bacteria 1800
510 2227414123 2225789004 Bacteria 26621
511 IMNBL1DRAFT_c0000103 3300000062 Bacteria 74715
512 IMNBL1DRAFT_c0011553 3300000062 Bacteria 4116
513 JGI24698J34947_10021059 3300002449 Bacteria 3510
514 JGI24703J35330_10805230 3300002501 Unclassified 538
515 Ga0111037_105193 3300008519 Bacteria 11025

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00203 Ribosomal_S19 Ribosomal protein S19 21 101 0.99

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.